DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and AGBL1

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001373023.1 Gene:AGBL1 / 123624 HGNCID:26504 Length:1121 Species:Homo sapiens


Alignment Length:310 Identity:61/310 - (19%)
Similarity:104/310 - (33%) Gaps:105/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YHDLETIYSFMR--EIRTKFPNIVRLY----TIGQTAEGRDLKVLRISENPRENKKVWID----- 201
            ||...|..:.|.  :|..|..|:..:|    .:.||..|....::.|:..|..|....::     
Human   730 YHYPYTYTALMTHLDILEKSVNLKEVYFRQDVLCQTLGGNPCPLVTITAMPESNSDEHLEQFRHR 794

  Fly   202 ------GGIHARE----WISPATVTFILYQLMSDWENQP-AHI--RGLTWYIMPVMNPDGYEYSR 253
                  ..:|..|    |:...|:.|::       .:.| |.:  ....:.|:|::||||.    
Human   795 PYQVITARVHPGESNASWVMKGTLEFLV-------SSDPVARLLRENFIFKIIPMLNPDGV---- 848

  Fly   254 TTNRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAK 318
                     .:.:.|...||.||||.    |....:...|.....:|..                
Human   849 ---------INGNHRCSLSGEDLNRQ----WLSPSAHLQPTIYHAKGLL---------------- 884

  Fly   319 RKYNLES-------YLTFHSYGQ---MIVYPWAYK------AVKVKDASVLQRVSSLAAERILQK 367
              |:|.|       :..||.:.|   :.:|..:.|      |..|..:::|:.|:.....:||.|
Human   885 --YHLSSIGRSPVVFCDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYRTLPKILDK 947

  Fly   368 TGTSY------------RAAVTHEVLGIAGGGSDDWSRAALGVKYVYTIE 405
            ...::            ||:....|:         |..  :||...||:|
Human   948 LAPAFTMSSCSFLVEKSRASTARVVV---------WRE--MGVSRSYTME 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416
M14_CP_A-B_like 148..439 CDD:199844 61/310 (20%)
AGBL1NP_001373023.1 Pepdidase_M14_N 596..730 CDD:407865 61/310 (20%)
M14_Nna1 754..1019 CDD:349477 54/286 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.