DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and LOC100490370

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_031749426.1 Gene:LOC100490370 / 100490370 -ID:- Length:491 Species:Xenopus tropicalis


Alignment Length:415 Identity:143/415 - (34%)
Similarity:221/415 - (53%) Gaps:53/415 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GGNIWKENSKFLDIS-IARDQLKAARSFLSAHRLD------PQILSHNIQS------------MI 116
            ||||       |:|: .:..|::..::.|.:..||      |:.:  |:::            ::
 Frog    64 GGNI-------LEITPESEKQVQCLQNILQSWLLDLLKPLQPEDI--NVKTTVHVRIPSTALQLV 119

  Fly   117 DEELLEGIQSSSFGHG------------RRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIV 169
            .|:||...||.....|            :.|:|.. :..::..||.:..||.::..|..|....|
 Frog   120 KEDLLHCSQSLEILTGNVKYIEEDKIDTKETRKTI-NEYNYTTYHPMNEIYDWINGIAKKHSQFV 183

  Fly   170 RLYTIGQTAEGRDLKVLRISENPRENKK--VWIDGGIHAREWISPATVT-FILYQLMSDWENQP- 230
            ..:.:|.|.|.|.::.|:||: |.||.|  ||||.||||||||:||... |:..|::.:::|.. 
 Frog   184 TQHLLGLTYESRPMQYLKISQ-PSENHKKIVWIDCGIHAREWIAPAFCQWFVKEQIVQNYQNDQR 247

  Fly   231 --AHIRGLTWYIMPVMNPDGYEYSRTTNRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNP 293
              ..::.|..|::||:|.|||.||.|..||||||||......|.||||||||::.|..:.||||.
 Frog   248 IRKILQNLDIYVLPVLNIDGYIYSWTKERLWRKNRSQYGNGTCYGVDLNRNFNVSWCTHRSSTNC 312

  Fly   294 CSDTYRGSAPASERETRAVAEFLAKRKYNLESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSS 358
            .|:::.||:|.||.|||||.||:..||.::..:||.|||.|:|:..:.|.....::.:.:.:|:.
 Frog   313 SSNSFCGSSPVSEPETRAVVEFVESRKADIVCFLTMHSYSQLILTAYGYSTGLSRNYNEIFKVAE 377

  Fly   359 LAAERILQKTGTSYRAAVTHEVLGIAGGGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKD 423
            :||..:.:..||.|||....::|..|.|.|.||.. .||:.:.:|.||||.|::.|.||...|:.
 Frog   378 MAASAMEKIHGTKYRAGPFSKLLYEASGTSQDWVH-DLGIDFSFTFELRDNGSHKFTLPEDQIQP 441

  Fly   424 TALEG----WTVVETVAQAIGPSSS 444
            |..|.    .|::|.|.:...|:.:
 Frog   442 TCEETMAGVMTIIEYVNEKYFPNKA 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 12/65 (18%)
M14_CP_A-B_like 148..439 CDD:199844 122/300 (41%)
LOC100490370XP_031749426.1 Propep_M14 73..>123 CDD:396700 7/51 (14%)
Peptidase_M14_like 159..457 CDD:416253 121/299 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.