DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and cpo

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:321 Identity:118/321 - (36%)
Similarity:176/321 - (54%) Gaps:26/321 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 EELLEGIQSSSFGHGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRD 182
            :.|..|::..|:.:   ||           ||.::.|.::|.:::.:.|::|...|.|||.|.|:
Zfish    19 DRLAGGLEHKSYDY---TK-----------YHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRN 69

  Fly   183 LKVLRI---SENPRENKKVWIDGGIHAREWISPATVTFILYQLMSDWENQP---AHIRGLTWYIM 241
            :.:|:|   |..|:  |.:|:|.||||||||:||.....:.:::..::...   ...:.|.:||.
Zfish    70 ITLLKIGFSSTTPK--KAIWMDCGIHAREWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYIT 132

  Fly   242 PVMNPDGYEYSRTTN--RLWRKNRSP-SRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAP 303
            ||:|.|||.||...|  |||||:||| ...:.|||.||||||...|...|.|.|.||:.|.|:..
Zfish   133 PVLNMDGYIYSWLNNSTRLWRKSRSPCHENSTCSGTDLNRNFYANWGMVGISRNCCSEVYNGATA 197

  Fly   304 ASERETRAVAEFLAKRKYNLESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKT 368
            .||.|..||.:||...:.:|..|||.|||||:|:.|:.:..:...:...|..|...||:.|....
Zfish   198 LSEPEAEAVTDFLGAHQNHLLCYLTIHSYGQLILVPYGHPNISAPNYDELMEVGLAAAKAIKAVH 262

  Fly   369 GTSYRAAVTHEVLGIAGGGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGW 429
            |.||:...:.:||....|.|.|::| .:|:.|.:|.||||.|.:||:||...|:.|..|.:
Zfish   263 GKSYKVGSSPDVLYPNSGSSRDFAR-LIGIPYSFTFELRDEGQHGFILPEDQIQPTCQEAY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 118/321 (37%)
M14_CP_A-B_like 148..439 CDD:199844 113/291 (39%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 113/291 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593410
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.