powered by:
Protein Alignment CG15771 and YOR131C
DIOPT Version :9
Sequence 1: | NP_001284909.1 |
Gene: | CG15771 / 31500 |
FlyBaseID: | FBgn0029801 |
Length: | 355 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014774.1 |
Gene: | YOR131C / 854299 |
SGDID: | S000005657 |
Length: | 218 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 51 |
Identity: | 17/51 - (33%) |
Similarity: | 27/51 - (52%) |
Gaps: | 2/51 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 167 FDCVLVSSDLPWEKPHPEIFYAACNFLNVKPQECVMIGDKLETDIKGGHLA 217
||.::.....| .||.|:......:.||::|.|.:|:||..: |:|.|..|
Yeast 125 FDYIVTREFRP-TKPQPDPLLHIASKLNIRPLEMIMVGDSFD-DMKSGRSA 173
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.