DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and YOR131C

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_014774.1 Gene:YOR131C / 854299 SGDID:S000005657 Length:218 Species:Saccharomyces cerevisiae


Alignment Length:51 Identity:17/51 - (33%)
Similarity:27/51 - (52%) Gaps:2/51 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 FDCVLVSSDLPWEKPHPEIFYAACNFLNVKPQECVMIGDKLETDIKGGHLA 217
            ||.::.....| .||.|:......:.||::|.|.:|:||..: |:|.|..|
Yeast   125 FDYIVTREFRP-TKPQPDPLLHIASKLNIRPLEMIMVGDSFD-DMKSGRSA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 17/51 (33%)
HAD-SF-IA-v1 31..218 CDD:273686 17/51 (33%)
YOR131CNP_014774.1 Gph 10..213 CDD:223620 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.