DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and AT1G14310

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_172883.2 Gene:AT1G14310 / 837992 AraportID:AT1G14310 Length:254 Species:Arabidopsis thaliana


Alignment Length:111 Identity:33/111 - (29%)
Similarity:59/111 - (53%) Gaps:9/111 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 YRYLA------VPADYVQLLLRMRQAGYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSDLPW 178
            |:|.|      :|....:.:..::.||..:|:::|..:..: :.:.:|||...||.|:||:::.:
plant   126 YQYYANGEAWHLPEGAYETMSLLKDAGVKMAVVSNFDTRLR-KLLKDLNVIDMFDAVIVSAEVGY 189

  Fly   179 EKPHPEIFYAACNFLNVKPQECVMIGDKLETDIKGGHLAQLGLTFW 224
            |||...||.:|...::|.....|.:||....| |||..| :|:..|
plant   190 EKPDERIFKSALEQISVDVNRAVHVGDDEGAD-KGGANA-IGIACW 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 33/111 (30%)
HAD-SF-IA-v1 31..218 CDD:273686 30/103 (29%)
AT1G14310NP_172883.2 DREG-2 45..234 CDD:274056 33/111 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.