DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and AT2G38740

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_565895.1 Gene:AT2G38740 / 818456 AraportID:AT2G38740 Length:244 Species:Arabidopsis thaliana


Alignment Length:247 Identity:60/247 - (24%)
Similarity:96/247 - (38%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AKIRAFYFDLDNTLIPTRAGDSKAIRKLADFLETQYQFSKDDATQATQNFLKAFRRCPDNSQTSL 88
            |.:.|..||:|.||.     ||..|..:| |.|...:...::.....:.|.........||:.:|
plant    20 APLEAILFDVDGTLC-----DSDPIHLIA-FQELLQEIGFNNGVPIDEKFFVENIAGKHNSEIAL 78

  Fly    89 DSWRTHLWR------ESLPARHKHLAEQIYP--------KWLKLRYRYLAVPADYVQLLLRMRQA 139
            ..:...:.|      |......|.:||:|.|        ||::.|                    
plant    79 LLFPDDVSRGLKFCDEKEALYRKIVAEKIKPLDGLIKLTKWIEDR-------------------- 123

  Fly   140 GYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSDLPWEKPHPEIFYAACNFLNVKPQECVMIG 204
            |...|.:||.|.......:::|.:..:|..|::.|:..:.||||..:..|...|||..:..::..
plant   124 GLKRAAVTNAPKENAELMISKLGLTDFFQAVILGSECEFPKPHPGPYLKALEVLNVSKEHTLVFE 188

  Fly   205 DKLETDIKGGHLA---QLGLTFWTPLSNSSAAAQSLEDVEYKPHVKLGSLLE 253
            |.: :.||.|..|   .:|||...|.|....|..:.. :|.....||.::||
plant   189 DSI-SGIKAGVAAGMPVIGLTTGNPASLLMQAKPAFL-IENYADPKLWAVLE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 59/246 (24%)
HAD-SF-IA-v1 31..218 CDD:273686 47/203 (23%)
AT2G38740NP_565895.1 PLN02770 1..244 CDD:215413 60/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I2668
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.