DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and ACAD10

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001130010.1 Gene:ACAD10 / 80724 HGNCID:21597 Length:1090 Species:Homo sapiens


Alignment Length:212 Identity:48/212 - (22%)
Similarity:84/212 - (39%) Gaps:45/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RAFYFDLDNTLIPT------------RAGDSKAIRKLADFLET--QYQFSKDDATQATQNFLKAF 77
            ||..||:...|||:            |......::.|.:..|.  ..:|.:.:.|  .:.||:.|
Human    43 RAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEIT--AEGFLREF 105

  Fly    78 -RRCPDNSQTS--LDSWRTHLWRESLPARHKHLAEQIYPKWLKLRYRYLAVPADYVQLLLRMRQA 139
             |.|.:..:||  :||:.:.|..|.:..:...:.|.|                      .::|..
Human   106 GRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAI----------------------TQIRAK 148

  Fly   140 GYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSDLPWEKPHPEIFYAACNFLNVKPQECVMIG 204
            |...|:::|.......:....|: |..||.::.|......||.|.|:......|.::|.|.:.: 
Human   149 GLQTAVLSNNFYLPNQKSFLPLD-RKQFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIFL- 211

  Fly   205 DKLETDIKGGHLAQLGL 221
            |.|.|::|  ..|:||:
Human   212 DDLGTNLK--EAARLGI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 48/212 (23%)
HAD-SF-IA-v1 31..218 CDD:273686 43/203 (21%)
ACAD10NP_001130010.1 HAD-1A3-hyp 41..278 CDD:274054 48/212 (23%)
HAD_like 46..238 CDD:304363 46/209 (22%)
PLN02876 288..1087 CDD:215473
ACAD10_11_N-like 317..567 CDD:270703
ACAD 694..1087 CDD:299127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.