DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and Hdhd3

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_077219.1 Gene:Hdhd3 / 72748 MGIID:1919998 Length:251 Species:Mus musculus


Alignment Length:283 Identity:64/283 - (22%)
Similarity:112/283 - (39%) Gaps:60/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KIRAFYFDLDNTLIPTR--AGDSKAIRKLADFLETQYQFSKDDATQATQNFLKAFRRCPDN---- 83
            ::|...:|:.:|||..|  .|:..|.:..|      :....:|.| ..|.|.:|:|....|    
Mouse     6 QMRLLTWDVKDTLIKLRRPVGEEYASKARA------HGVVVEDIT-VEQAFRQAYRAQSHNFPNY 63

  Fly    84 ----SQTSLDSWR---THLWR-ESLPARH--KHLAEQIYP------KWLKLRYRYLAVPADYVQL 132
                ..||...|:   .|.:| ..:|...  ..:|:|:|.      .|..|         :..::
Mouse    64 GLSRGLTSRQWWKDVVLHTFRLAGVPDAQAMTPVADQLYEDFSSPFTWQVL---------EGAEM 119

  Fly   133 LLR-MRQAGYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSDLPWEKPHPEIFYAACNFLNVK 196
            .|: .|:.|..||:::|.....: :.:..|.:|.:||.||.|..:...||.|.||..|.....|:
Mouse   120 TLKGCRKRGLKLAVVSNFDRRLE-DILTGLGLREHFDFVLTSEAVGCPKPDPRIFREALQRACVE 183

  Fly   197 PQECVMIGDKLETDIKGGHLAQLGLTFWTPLSNSSAAAQSLEDVEYKPHVKLGSLLEMYKYFPRL 261
            |.....:||....|.:|..  .:|:..:. ::.|.....::.|...|.|:           .|.|
Mouse   184 PAVAAHVGDSYLCDYQGSQ--AVGMHSFL-VAGSEPLDSAVRDSVPKEHI-----------LPSL 234

  Fly   262 NSVALPEMPSVSRRRGSHMSPIS 284
            :.:    :|::.....|  ||:|
Mouse   235 SHL----LPALDLLEAS--SPMS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 57/252 (23%)
HAD-SF-IA-v1 31..218 CDD:273686 51/209 (24%)
Hdhd3NP_077219.1 DREG-2 8..210 CDD:274056 53/220 (24%)
HAD_like 102..211 CDD:119389 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.