DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and nanp

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001017186.1 Gene:nanp / 549940 XenbaseID:XB-GENE-1008548 Length:240 Species:Xenopus tropicalis


Alignment Length:235 Identity:78/235 - (33%)
Similarity:120/235 - (51%) Gaps:14/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IRAFYFDLDNTLIPTRAGDSKAIRKLADFLETQYQFSKDDATQATQNFLKAFRRCP--DNSQTSL 88
            ::|.:||||||||.|.....|||.::...|..:.|:.:::|......| :|...|.  |:|..::
 Frog     6 VKAVFFDLDNTLIDTSGAGKKAIEEVVKVLIEKNQYKEEEALIICNKF-QAKLGCETLDSSTMTI 69

  Fly    89 DSWRTHLWRESL----PARHKHLAEQIYPKWLKLRYRYLAVPADYVQLLLRMRQAGYALALITNG 149
            |..|...|.::|    ...||.:|...|..|...|.:.|.:..:...:|..:|:: ..|.|:|||
 Frog    70 DDLRVQHWEDALQEVRQGDHKKVAMDCYTLWKTRRLQLLTMSENTKDMLCELRKS-TRLVLLTNG 133

  Fly   150 PSNAQWEKVAELNVRGYFDCVLVSSDLPWEKPHPEIFYAACNFLNVKPQECVMIGDKLETDIKGG 214
            ....|.||:.....:.:||.|:|..:...|||.|.|||..|:.:.|.|.:|||:||.|:|||:||
 Frog   134 VGQVQREKIESCGAQQFFDAVVVGGEHAEEKPAPSIFYHCCDLIRVLPGDCVMVGDNLDTDIQGG 198

  Fly   215 HLAQLGLTFWTPLSNSSAAAQSLEDVEYKPHVKLGSLLEM 254
            ..|.|..|.|.   |.:   .|:..|...||..:.|::|:
 Frog   199 LNAGLKATIWL---NKN---PSIIKVSPTPHYTVKSVMEV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 78/235 (33%)
HAD-SF-IA-v1 31..218 CDD:273686 66/192 (34%)
nanpNP_001017186.1 CTE7 5..233 CDD:274057 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6154
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12112
Inparanoid 1 1.050 122 1.000 Inparanoid score I4591
OMA 1 1.010 - - QHG60072
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004462
OrthoInspector 1 1.000 - - oto105560
Panther 1 1.100 - - LDO PTHR46470
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5844
SonicParanoid 1 1.000 - - X3753
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.100

Return to query results.
Submit another query.