DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and ephx2

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001008642.1 Gene:ephx2 / 494099 ZFINID:ZDB-GENE-041212-70 Length:557 Species:Danio rerio


Alignment Length:227 Identity:53/227 - (23%)
Similarity:88/227 - (38%) Gaps:42/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SLPARHKHLAEQIYPKWLKLRYRYLAVPADYVQLLLRMRQAGYALALITN--GPSNAQWEKVAE- 160
            ||||:..  .::::....|:.:....:.|..|     :|:.|.|..::.|  ....||...:|. 
Zfish    80 SLPAQFS--TQKLFDDMGKVEFNMTFLDAAAV-----LRRNGIATGILANIWVDDTAQRGSIARV 137

  Fly   161 LNV-RGYFDCVLVSSDLPWEKPHPEIFYAACNFLNVKPQECVMIGDKLETDIKGGH--------- 215
            |:| ...||.||.|.......|.|:.|..|...|.|||||.:.: |..|..:|...         
Zfish   138 LSVLESRFDLVLRSCHAGVRIPEPDFFKHALEKLAVKPQEALWL-DVDEESVKAAEGLGIMAVQV 201

  Fly   216 ------LAQL----GLTFWTPLSNSSAAAQSLED--VEYKPHVKLGSLLEMYKYFPRLNSVALPE 268
                  |.::    |:...:.|...|...:.:..  |..||.||: ..:||....|.|.....||
Zfish   202 KDVTEALTEIQKLTGIEVTSDLQPPSCDPEKVSHGYVNIKPGVKI-HYVEMGDGPPVLLCHGFPE 265

  Fly   269 --------MPSVSRRRGSHMSPISQGSGSGSS 292
                    :|:::......::|..:|.|..::
Zfish   266 SWFSWRYQIPALADAGFRVLAPDMKGYGGSTA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 44/180 (24%)
HAD-SF-IA-v1 31..218 CDD:273686 35/137 (26%)
ephx2NP_001008642.1 HAD-1A3-hyp 3..217 CDD:274054 35/144 (24%)
HAD_like <155..203 CDD:304363 13/48 (27%)
Abhydrolase 237..>358 CDD:304388 15/62 (24%)
Abhydrolase_1 255..531 CDD:278959 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.