DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and CG15912

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster


Alignment Length:268 Identity:67/268 - (25%)
Similarity:109/268 - (40%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SHFDATCAKIRAFYFDLDNTLIPTRAGDSKAIRKLADFLETQYQFSKD------DATQATQNFLK 75
            |.|.|...:.|...||:.:||:           :|.|.|...:|.:::      |..:..|.|.:
  Fly     5 SQFVANLKRFRLVTFDVTDTLL-----------RLEDPLRQYHQTAEEFGVTGVDRRRLEQCFRQ 58

  Fly    76 AFRRC----PDNSQTS--LDSWRTHLWRESLPARHKHLAEQ-IYPKWL-KLRYRYLAVPADYV-- 130
            .|:..    |:..:.|  || |:.  |...|.||.....:. :.|:.| |:..|.::|.....  
  Fly    59 QFKAMSSEHPNFGRYSPGLD-WQR--WWLQLVARTFSCVDHGLAPEKLEKIGQRLISVFRTSACW 120

  Fly   131 -------QLLLRMRQAGYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSDLPWEKPHPEIFYA 188
                   :|:..:|.||..:.:|:|..|:.. :.:..:...|.||.:|.|.:....||...||..
  Fly   121 SHVNGAQELVQNVRNAGKCVGIISNFDSSLP-QVLDAMGFAGKFDFILTSYEAGVMKPERGIFEI 184

  Fly   189 ACNFLNVKPQECVMIGDKLETDIKGGHLAQLGLTFWTPLSNSSAAAQSLEDVEYKPH--VKLGSL 251
            ....|.:..::.:.||:||:.|.:|..  ..|   |:.|..|:|.         .||  ..|.||
  Fly   185 PLQRLQIPAEQALHIGNKLDMDYEGAR--NCG---WSGLLVSNAD---------NPHSFASLSSL 235

  Fly   252 LEMYKYFP 259
            ||..|..|
  Fly   236 LEALKTQP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 62/254 (24%)
HAD-SF-IA-v1 31..218 CDD:273686 49/209 (23%)
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 52/223 (23%)
HAD-SF-IA-v1 16..214 CDD:273686 49/214 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.