DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and K01G5.10

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_499376.1 Gene:K01G5.10 / 186851 WormBaseID:WBGene00010481 Length:248 Species:Caenorhabditis elegans


Alignment Length:226 Identity:56/226 - (24%)
Similarity:92/226 - (40%) Gaps:40/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTATHSHFDATCAKIRAFYFDLDNTLIPTRAGDSKAIRKLADFLETQYQFSKDDATQATQNFLKA 76
            |..|.|...:|...::....|..:|||..:........:.|    .||.. :.|:.|...:|||.
 Worm     5 LLRTTSRNLSTPPVVKVLSLDARDTLITMKESPPIVYSRFA----RQYDL-EVDSDQIMGSFLKN 64

  Fly    77 FRR------CPDNSQTSLDSWRTHLWRE------------SLPARHKHLAEQIY-----PKWLKL 118
            ::|      |...:.....||    |.|            |...|.:.:|..:|     |:..||
 Worm    65 YKRMSIASPCFGFNGIGNKSW----WIEVVSSTLLDCAPDSEKGRVEVIAGALYNHYATPEPWKL 125

  Fly   119 RYRYLAVPADYVQLLLRMRQAGYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSDLPWEKPHP 183
                  |.:|..|.|.::|..|..|.:|:|..|..: ..:::.|:...|...::|.::.:|||..
 Worm   126 ------VESDTRQTLQKLRLKGIILVVISNFDSRLK-SLLSQFNLLDLFSMTVLSGEIGYEKPDE 183

  Fly   184 EIFYAACNFLN-VKPQECVMIGDKLETDIKG 213
            :||....|..: :.|.|.:.|||.|:.|..|
 Worm   184 KIFQLVVNHFDLISPSEILHIGDNLKNDFHG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 52/213 (24%)
HAD-SF-IA-v1 31..218 CDD:273686 52/207 (25%)
K01G5.10NP_499376.1 DREG-2 20..224 CDD:274056 52/211 (25%)
HAD-SF-IA-v1 21..219 CDD:273686 52/210 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.