Sequence 1: | NP_001284909.1 | Gene: | CG15771 / 31500 | FlyBaseID: | FBgn0029801 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509345.2 | Gene: | F45E1.4 / 185793 | WormBaseID: | WBGene00018465 | Length: | 287 | Species: | Caenorhabditis elegans |
Alignment Length: | 261 | Identity: | 59/261 - (22%) |
---|---|---|---|
Similarity: | 89/261 - (34%) | Gaps: | 80/261 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 FDLDNTL-------IPTRAGDSKAIR---------KLADFL----------------ETQYQFSK 63
Fly 64 DDATQATQNFLKAF--RRCPDNSQT-SLDS-WRTHLWRESLPARHKHLAEQIYPKWLKLRYRYLA 124
Fly 125 VPADYVQLLLRMRQAGYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSD---LPWEKPHPEIF 186
Fly 187 YAACNFLNVKPQECVMIGDKLETDIKGGHLAQLGLTFWTPLSNSSAAAQSLEDVEYKPHVKLGSL 251
Fly 252 L 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15771 | NP_001284909.1 | CTE7 | 25..255 | CDD:274057 | 59/261 (23%) |
HAD-SF-IA-v1 | 31..218 | CDD:273686 | 50/225 (22%) | ||
F45E1.4 | NP_509345.2 | Gph | 50..276 | CDD:223620 | 59/261 (23%) |
HAD_like | 141..248 | CDD:119389 | 31/136 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0004462 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |