DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and F45E1.4

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_509345.2 Gene:F45E1.4 / 185793 WormBaseID:WBGene00018465 Length:287 Species:Caenorhabditis elegans


Alignment Length:261 Identity:59/261 - (22%)
Similarity:89/261 - (34%) Gaps:80/261 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FDLDNTL-------IPTRAGDSKAIR---------KLADFL----------------ETQYQFSK 63
            ||.|.||       ||.....:::|.         |:|..|                .|..|.:.
 Worm    53 FDKDGTLLCFHTMWIPWIQHTAQSIETSTGLVLFPKIAQSLGLCLAENKVKPGLLAEGTTGQIAN 117

  Fly    64 DDATQATQNFLKAF--RRCPDNSQT-SLDS-WRTHLWRESLPARHKHLAEQIYPKWLKLRYRYLA 124
            :.::....|.:|:|  |...:||.| |.|. ..|.|.:|.                         
 Worm   118 EISSLLMDNGIKSFEAREITNNSLTNSYDKILSTDLVKEL------------------------- 157

  Fly   125 VPADYVQLLLRMRQAGYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSD---LPWEKPHPEIF 186
              ||.|.|..|::|.|..:|:.|.....:....:..:||....|.::...|   .|  ||.|...
 Worm   158 --ADTVALFTRLKQHGTKIAVCTADNRKSSLLALKRMNVDHLVDMIVCGDDKNTAP--KPSPHNA 218

  Fly   187 YAACNFLNVKPQECVMIGDKLETDIKGGHLAQLGLTFWTPLSNSSAAAQSLEDVEYKPHVKLGSL 251
            ...|..|.|...:.:|:|| ...|::..|.|:||           ||...|..:..|.|:....:
 Worm   219 IKICKHLGVDQSKAIMVGD-TRVDMEMAHNAELG-----------AAVGVLSGIGCKDHLHRADV 271

  Fly   252 L 252
            |
 Worm   272 L 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 59/261 (23%)
HAD-SF-IA-v1 31..218 CDD:273686 50/225 (22%)
F45E1.4NP_509345.2 Gph 50..276 CDD:223620 59/261 (23%)
HAD_like 141..248 CDD:119389 31/136 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004462
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.