DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and F09C3.2

DIOPT Version :9

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_493493.2 Gene:F09C3.2 / 184226 WormBaseID:WBGene00008610 Length:250 Species:Caenorhabditis elegans


Alignment Length:135 Identity:35/135 - (25%)
Similarity:62/135 - (45%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 DYVQLLLRMRQAGYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSD---LPWEKPHPEIFYAA 189
            |...|...::..|..:|:.|.....|..:::.::||..:.|.::..:|   :|  ||.|......
 Worm   114 DMPALFTTLKSMGIKIAVCTADSRAATMDQMNKMNVIPFLDDIICGNDVGIVP--KPSPHCAIQI 176

  Fly   190 CNFLNVKPQECVMIGDKLETDIKGGHLAQL--GLTFWTPLSNSSAAAQ----SLEDVEYKPHVKL 248
            |..|.|:.:|.:|:||.: .|:|.|.:|.|  .:...|.:......||    .|||:...||:..
 Worm   177 CKRLGVELKETLMVGDTI-ADLKMGKIAGLRASVAVMTGVGTRDTLAQYSDYFLEDISELPHLIT 240

  Fly   249 GSLLE 253
            .::.|
 Worm   241 KTMTE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 35/135 (26%)
HAD-SF-IA-v1 31..218 CDD:273686 24/92 (26%)
F09C3.2NP_493493.2 Gph 8..239 CDD:223620 34/127 (27%)
HAD_like 114..211 CDD:119389 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004462
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.