DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-52 and lin52

DIOPT Version :9

Sequence 1:NP_001284908.1 Gene:lin-52 / 31499 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001071264.1 Gene:lin52 / 777755 ZFINID:ZDB-GENE-061110-82 Length:112 Species:Danio rerio


Alignment Length:105 Identity:42/105 - (40%)
Similarity:61/105 - (58%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EDELISMETL-RPSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|||:|.| |.||..|||:.||:.||.:....|:......:.:.|..:|:..:.||..|...:
Zfish    11 ESSLISLENLDRASPDLWPEQLPGVSEFAASFKNPITNSPPKWMAELESEDIEMLKELGSLTTAN 75

  Fly   116 LIDKIKSMHDEIYQLGLREAMEMTRGKLLGIFDRDRAPKR 155
            |::|:|.:.:..|||||.|:.||||||.|.|.:|   ||:
Zfish    76 LMEKVKGLQNLAYQLGLEESREMTRGKFLNILER---PKK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 37/92 (40%)
lin52NP_001071264.1 LIN52 14..107 CDD:287062 37/92 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580336
Domainoid 1 1.000 76 1.000 Domainoid score I8966
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5211
OMA 1 1.010 - - QHG48791
OrthoDB 1 1.010 - - D1513733at2759
OrthoFinder 1 1.000 - - FOG0007389
OrthoInspector 1 1.000 - - oto40450
orthoMCL 1 0.900 - - OOG6_107514
Panther 1 1.100 - - LDO PTHR31489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5845
SonicParanoid 1 1.000 - - X7386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.