DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-52 and lin52

DIOPT Version :9

Sequence 1:NP_001284908.1 Gene:lin-52 / 31499 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001016782.1 Gene:lin52 / 549536 XenbaseID:XB-GENE-5889227 Length:112 Species:Xenopus tropicalis


Alignment Length:105 Identity:40/105 - (38%)
Similarity:63/105 - (60%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EDELISMETL-RPSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|:|.|.| |.||..|||:.||:.||.:...:|:.:....:.:.|.:||:..:.||..|...:
 Frog    11 ETSLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPIKSTPRKWMAELENDDIDMLKELGSLTTAN 75

  Fly   116 LIDKIKSMHDEIYQLGLREAMEMTRGKLLGIFDRDRAPKR 155
            |::|::.:.:..|||||.|:.||||||.|.|.::   ||:
 Frog    76 LMEKVRGLQNLAYQLGLDESREMTRGKFLNILEK---PKK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 36/92 (39%)
lin52NP_001016782.1 LIN52 14..107 CDD:370793 36/92 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9094
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5092
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513733at2759
OrthoFinder 1 1.000 - - FOG0007389
OrthoInspector 1 1.000 - - oto105475
Panther 1 1.100 - - LDO PTHR31489
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.