DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-52 and Lin52

DIOPT Version :9

Sequence 1:NP_001284908.1 Gene:lin-52 / 31499 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_006240418.1 Gene:Lin52 / 362763 RGDID:1306798 Length:157 Species:Rattus norvegicus


Alignment Length:128 Identity:35/128 - (27%)
Similarity:58/128 - (45%) Gaps:23/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EDELISMETL-RPSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|:|.|.| |.||..|||:.||:.||.:...:|:.:....:.:.:..||:..:.||..|...:
  Rat    15 EASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPTWMAEIERDDIDMLKELGSLTTAN 79

  Fly   116 LIDKIKSMHDEIYQLGLREAMEMT----------------------RGKLLGIFDRDRAPKRQ 156
            |::|::.:.:..|||||.|..:..                      .|.||.:.|.:...||:
  Rat    80 LMEKVRGLQNLAYQLGLDECKDKPSEGSSRCFQLSVDSHQQSTPAGAGSLLPLLDFELHAKRK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 31/114 (27%)
Lin52XP_006240418.1 LIN52 18..100 CDD:401871 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340535
Domainoid 1 1.000 56 1.000 Domainoid score I10783
eggNOG 1 0.900 - - E1_KOG4402
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5331
OMA 1 1.010 - - QHG48791
OrthoDB 1 1.010 - - D1513733at2759
OrthoFinder 1 1.000 - - FOG0007389
OrthoInspector 1 1.000 - - oto98782
orthoMCL 1 0.900 - - OOG6_107514
Panther 1 1.100 - - LDO PTHR31489
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.