DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-52 and Lin52

DIOPT Version :9

Sequence 1:NP_001284908.1 Gene:lin-52 / 31499 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_036013218.1 Gene:Lin52 / 217708 MGIID:3045391 Length:126 Species:Mus musculus


Alignment Length:84 Identity:29/84 - (34%)
Similarity:48/84 - (57%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EDELISMETL-RPSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|:|.|.| |.||..|||:.||:.||.:...:|:.:....:.:.:..||:..:.||..|...:
Mouse    15 EASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTAN 79

  Fly   116 LIDKIKSMHDEIYQLGLRE 134
            |::|::.:.:..|||||.|
Mouse    80 LMEKVRGLQNLAYQLGLDE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 28/81 (35%)
Lin52XP_036013218.1 LIN52 18..98 CDD:401871 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836827
Domainoid 1 1.000 71 1.000 Domainoid score I9434
eggNOG 1 0.900 - - E1_KOG4402
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5266
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48791
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007389
OrthoInspector 1 1.000 - - oto95297
orthoMCL 1 0.900 - - OOG6_107514
Panther 1 1.100 - - LDO PTHR31489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5845
SonicParanoid 1 1.000 - - X7386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.