DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-52 and lin-52

DIOPT Version :9

Sequence 1:NP_001284908.1 Gene:lin-52 / 31499 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001255033.1 Gene:lin-52 / 176393 WormBaseID:WBGene00003035 Length:161 Species:Caenorhabditis elegans


Alignment Length:135 Identity:34/135 - (25%)
Similarity:63/135 - (46%) Gaps:24/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DEEV-------EKASASSSSTLLAEKDVPEVKERPITPEDELISMETLRPSPVQWPERFPGMDEF 78
            |:|:       :|::|..:..|..:|.:.|..| .:..|.|.:.|:.|     .:.|.|  ..|.
 Worm    14 DDEMFVQQMIEKKSNAEQAKMLEQQKKMLECTE-TMPEESEPVPMKCL-----DFEEAF--QSES 70

  Fly    79 LSMSDTPMYTRSTNYTSNLT--DDDMVKINELAQLPPEDLIDKIKSMHDEIYQLGLREAMEMTRG 141
            :|......|       .|::  .:|.|.:|.::..|.:|:...|:::.:.:|.||:.||.:..||
 Worm    71 VSKGYESPY-------KNISFLKEDAVTVNTMSHCPADDIAKLIRNIQNSVYTLGIEEARQCRRG 128

  Fly   142 KLLGI 146
            |||.:
 Worm   129 KLLNV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 24/94 (26%)
lin-52NP_001255033.1 LIN52 <86..134 CDD:287062 12/49 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159096
Domainoid 1 1.000 42 1.000 Domainoid score I8493
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107514
Panther 1 1.100 - - LDO PTHR31489
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.