DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15772 and CG12054

DIOPT Version :9

Sequence 1:NP_001284907.1 Gene:CG15772 / 31498 FlyBaseID:FBgn0029799 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651853.1 Gene:CG12054 / 43694 FlyBaseID:FBgn0039831 Length:628 Species:Drosophila melanogaster


Alignment Length:113 Identity:39/113 - (34%)
Similarity:44/113 - (38%) Gaps:38/113 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MPSQVASNTGTPAPS------------AGGIHQQHQQQQHQQHQQQ-----QHQQQQHQQHQQQQ 64
            :|:.|.....|||.|            ..|..||.|.......::.     |...|..||.||||
  Fly   456 LPNLVNLGILTPATSPTKNTQTLTFTTTNGSTQQQQALVASLSKKTNILLLQEPTQLVQQVQQQQ 520

  Fly    65 QQQHQHQQQQQQHLQQQQHHQL--------------------QQQQQQ 92
            |||.|.|||.||.: |||||.|                    ||||||
  Fly   521 QQQQQQQQQLQQQV-QQQHHVLPISPTSSVSGNSSKSSSPTPQQQQQQ 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15772NP_001284907.1 TMV_coat 114..>197 CDD:250082
CG12054NP_651853.1 SFP1 <123..231 CDD:227516
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5189
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.