DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15772 and K07E3.1

DIOPT Version :9

Sequence 1:NP_001284907.1 Gene:CG15772 / 31498 FlyBaseID:FBgn0029799 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001361921.1 Gene:K07E3.1 / 181068 WormBaseID:WBGene00019490 Length:1050 Species:Caenorhabditis elegans


Alignment Length:195 Identity:37/195 - (18%)
Similarity:58/195 - (29%) Gaps:61/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EEIGCQRQTGIVVAMP--SQVASNTGTPAPSAGGIHQQHQQQQHQQ------------------- 46
            :..|.:.....:::|.  :::|:|.|.|..|.  |:....::.:.|                   
 Worm   116 QHFGVELSGNPIMSMAPITELATNGGLPTSST--IYSPQSEEYYTQSANNRYYDKIFGDHKTFDN 178

  Fly    47 ----------------HQQQQHQQQQHQQHQQQQQQQHQ-------HQQQQQQHLQQQQHHQLQ- 87
                            |....|.|.....|.||.||..|       :|...|.|...|.....| 
 Worm   179 IMQKNSRTPNMPVPKVHPMPYHPQMNKGNHYQQLQQYTQPPPVYNAYQPPPQMHYNAQPRMAYQV 243

  Fly    88 QQQQQQQHQQLASNMSLLTVKGGRYLWTDRELLMHLQNYTPLILLIDFVEKTRTKRF-YESSERY 151
            ..|...|...:...|:.:.::...|..|.     :.|.|.|        .....||: .||..||
 Worm   244 AYQAVPQFVHMPVQMAPVVMQDNVYAGTS-----YRQVYIP--------PAYSAKRYGSESRSRY 295

  Fly   152  151
             Worm   296  295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15772NP_001284907.1 TMV_coat 114..>197 CDD:250082 10/39 (26%)
K07E3.1NP_001361921.1 DAZAP2 187..>280 CDD:371348 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5189
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.