Sequence 1: | NP_001284907.1 | Gene: | CG15772 / 31498 | FlyBaseID: | FBgn0029799 | Length: | 259 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001361921.1 | Gene: | K07E3.1 / 181068 | WormBaseID: | WBGene00019490 | Length: | 1050 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 37/195 - (18%) |
---|---|---|---|
Similarity: | 58/195 - (29%) | Gaps: | 61/195 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EEIGCQRQTGIVVAMP--SQVASNTGTPAPSAGGIHQQHQQQQHQQ------------------- 46
Fly 47 ----------------HQQQQHQQQQHQQHQQQQQQQHQ-------HQQQQQQHLQQQQHHQLQ- 87
Fly 88 QQQQQQQHQQLASNMSLLTVKGGRYLWTDRELLMHLQNYTPLILLIDFVEKTRTKRF-YESSERY 151
Fly 152 151 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15772 | NP_001284907.1 | TMV_coat | 114..>197 | CDD:250082 | 10/39 (26%) |
K07E3.1 | NP_001361921.1 | DAZAP2 | 187..>280 | CDD:371348 | 22/105 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5189 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |