DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtel1 and AT1G09995

DIOPT Version :10

Sequence 1:NP_572254.1 Gene:Rtel1 / 31497 FlyBaseID:FBgn0029798 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_683295.1 Gene:AT1G09995 / 837534 AraportID:AT1G09995 Length:88 Species:Arabidopsis thaliana


Alignment Length:180 Identity:40/180 - (22%)
Similarity:61/180 - (33%) Gaps:71/180 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LPASLVVSHPYFTTYHHHQPRTSSVSSSNSNSVNANSTMLLSPNFSPSPCPRRS---LPSTPLPN 69
            ||.:|:     |:.|...|...|  .||:|:||.....:....:...||..|.|   |.:|.:|.
plant   191 LPIALI-----FSGYAFAQMEVS--GSSSSSSVTKKKQVPRQNHTKWSPKLRLSVYFLLATNIPM 248

  Fly    70 G------HRRS----------------------LPPTPPTPAFSS--------------TSEQEE 92
            .      |:|.                      |.|...||.:|:              ::|:.|
plant   249 ALYMSLFHQRGTEDAMNYLSDEAYKGRVKSILFLMPCHSTPYYSTLHRNIPMQFLDCTPSAEKGE 313

  Fly    93 LFVNDEQI------------NDEEPE-----FPIRSTRLRSFDLRDGHIF 125
            |..:|:.:            |..||.     |....|:||.|.::  |.|
plant   314 LDESDQFLVNPLGFASELARNWSEPPSHIVLFASEETKLRDFMIQ--HSF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtel1NP_572254.1 rad3 10..742 CDD:273169 38/178 (21%)
HN_RTEL1 896..985 CDD:259826
AT1G09995NP_683295.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.