DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4078 and AT2G05635

DIOPT Version :9

Sequence 1:NP_001259262.1 Gene:CG4078 / 31497 FlyBaseID:FBgn0029798 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001318203.1 Gene:AT2G05635 / 2745433 AraportID:AT2G05635 Length:146 Species:Arabidopsis thaliana


Alignment Length:112 Identity:36/112 - (32%)
Similarity:52/112 - (46%) Gaps:19/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CSSLAWIRTRQSEHQKQMVKMEKA------DFSGLGGG---------APGGDLSELAKTMGRANN 103
            ||.|||.:..:|...|..:...||      |....|||         .|.....|.|:|..:...
plant    28 CSVLAWQQNYKSRLLKGNLTHSKAAPEAATDPLNHGGGFIPETQQRDTPASINVEKAETATKKRT 92

  Fly   104 WGVPKVIYASRTHSQLTQAMRELKRTAYANMRSVVLGSRDQLCIHPE 150
             .:|.:.||||||||:||.:||.::|.|....:|::|.   |.:|.:
plant    93 -KIPTIYYASRTHSQITQVIREYRKTGYRVPMAVLVGG---LGVHED 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4078NP_001259262.1 rad3 10..742 CDD:273169 36/112 (32%)
DEAD_2 111..274 CDD:284209 18/40 (45%)
Helicase_C_2 546..725 CDD:290046
HN_RTEL1 896..985 CDD:259826
AT2G05635NP_001318203.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D186062at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.