DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS6 and Gm648

DIOPT Version :9

Sequence 1:NP_001259259.1 Gene:IntS6 / 31496 FlyBaseID:FBgn0261383 Length:1284 Species:Drosophila melanogaster
Sequence 2:XP_011245900.2 Gene:Gm648 / 270599 MGIID:2685494 Length:245 Species:Mus musculus


Alignment Length:267 Identity:52/267 - (19%)
Similarity:90/267 - (33%) Gaps:92/267 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1009 LSPLGTST---PAASSSGLSSSSAYFSHNDINDASEISRILQTCHNGTSSGSSVGAGASNSNLNG 1070
            :||:|...   ||..:..|.    ..||..:.                :|..:.|.||..|....
Mouse    38 ISPVGEGEAMGPAKKNYTLD----MVSHKSLE----------------ASAEAKGEGALVSQKAQ 82

  Fly  1071 NGSTESGGGVSSDDHAS-------------LGGNS--FDALKRTAGTAGSTAAGNPHYYWASGLN 1120
            .|..|:...|.:.:.||             :.|:|  .|:|.|..|...:...|:.         
Mouse    83 VGMVEADPKVYAQNCASKQLMPVTGEAVLPMPGDSQTEDSLHRKDGGHDTVVGGSV--------- 138

  Fly  1121 HHNNNNSSAAGAASGSTLSNNHNHRGHNNSSPNKLEVKINSSCGSSPTHNNGGMGSPGQSLPLIF 1185
                |:.|:.|.|....:|::......::..||                                
Mouse   139 ----NSDSSEGTAKAPAMSSSEAQPYVSSLRPN-------------------------------- 167

  Fly  1186 TEEQREAARLHNVELRLQIFRDIRRPGRDYSQLLEHLNLVKGDQDMQSDFVDMCIVESLRFRRHR 1250
                     |.|.|::..:..:|||.||.|.:|.:.|..|:|..:::..||:..|.|:.||:|..
Mouse   168 ---------LSNYEIKCALMTEIRRFGRQYGRLFKILQEVQGPVEVRIQFVEFSIKEAARFKRRH 223

  Fly  1251 MASSIQE 1257
            :...:::
Mouse   224 LIQYLEK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS6NP_001259259.1 vWFA 4..>147 CDD:238119
INT_SG_DDX_CT_C 1196..1257 CDD:291946 19/60 (32%)
Gm648XP_011245900.2 INT_SG_DDX_CT_C 169..230 CDD:405888 19/60 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850779
Domainoid 1 1.000 42 1.000 Domainoid score I12371
eggNOG 1 0.900 - - E1_KOG3768
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.