DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS6 and CT45A9

DIOPT Version :10

Sequence 1:NP_572253.2 Gene:IntS6 / 31496 FlyBaseID:FBgn0261383 Length:1284 Species:Drosophila melanogaster
Sequence 2:NP_001278469.1 Gene:CT45A9 / 102723680 HGNCID:51262 Length:189 Species:Homo sapiens


Alignment Length:139 Identity:31/139 - (22%)
Similarity:62/139 - (44%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1134 SGSTLSNNHNHRGHNNSSPNKLEVKINSSCGSSPTHNNGGMGSPGQSLPL------IFTE---EQ 1189
            :||.:|........:...|::|:.:|:...|.|   .:..|..||.:.|:      .|:.   |.
Human    48 AGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFS---KDRMMQKPGSNAPVGGNVTSSFSGDDLEC 109

  Fly  1190 REAA------RLHNVELRLQIFRDIRRPGRDYSQLLEHLNLVKGDQDMQSDFVDMCIVESLRFRR 1248
            ||.|      :..|.:::.|:.:::|..|:.|.::.|.|..|:|...::..|.:..|.|:.|..|
Human   110 RETAFSPKSQQEINADIKRQLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMR 174

  Fly  1249 HRMASSIQE 1257
            ......:::
Human   175 RDFVKHLKK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS6NP_572253.2 VWA_2 4..131 CDD:463909
INT_SG_DDX_CT_C 1196..1256 CDD:464626 14/59 (24%)
CT45A9NP_001278469.1 INT_SG_DDX_CT_C 121..182 CDD:464626 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.