DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS6 and CT45A10

DIOPT Version :9

Sequence 1:NP_001259259.1 Gene:IntS6 / 31496 FlyBaseID:FBgn0261383 Length:1284 Species:Drosophila melanogaster
Sequence 2:NP_001278456.1 Gene:CT45A10 / 102723631 HGNCID:51263 Length:189 Species:Homo sapiens


Alignment Length:139 Identity:31/139 - (22%)
Similarity:61/139 - (43%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1134 SGSTLSNNHNHRGHNNSSPNKLEVKINSSCGSSPTHNNGGMGSPGQSLPL------IFTEEQREA 1192
            :||.:|........:...|::|:.:|:...|.|   .:|.|..||.:.|:      .|:.:..|.
Human    48 AGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFS---KDGMMQKPGSNAPVGGNVTSNFSGDDLEC 109

  Fly  1193 ARLH---------NVELRLQIFRDIRRPGRDYSQLLEHLNLVKGDQDMQSDFVDMCIVESLRFRR 1248
            ..:.         |.:::.|:.::||..||.|.::.|.|..|:|...::..|.:..|.|:.|..|
Human   110 RGIASSPKSQQEINADIKCQVVKEIRCLGRKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMR 174

  Fly  1249 HRMASSIQE 1257
            ......:::
Human   175 RDFVKHLKK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS6NP_001259259.1 vWFA 4..>147 CDD:238119
INT_SG_DDX_CT_C 1196..1257 CDD:291946 16/69 (23%)
CT45A10NP_001278456.1 INT_SG_DDX_CT_C 122..183 CDD:405888 16/60 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160431
Domainoid 1 1.000 42 1.000 Domainoid score I12419
eggNOG 1 0.900 - - E1_KOG3768
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.