DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15773 and CG34040

DIOPT Version :9

Sequence 1:NP_572251.1 Gene:CG15773 / 31494 FlyBaseID:FBgn0029795 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001033963.1 Gene:CG34040 / 3885655 FlyBaseID:FBgn0054040 Length:281 Species:Drosophila melanogaster


Alignment Length:222 Identity:56/222 - (25%)
Similarity:86/222 - (38%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGGLIIMGLAIVDSLECYACDSAEDSECATRPGQQLEVEECQQTGDECVTSISAGLTR-RGCLAR 80
            |..|::....::.|.:|..|   .|..| .|.....: |:|.:..|.||:...||:.: :|||..
  Fly    10 LVALVLTSSYVLASEKCIYC---RDINC-QRSSYDAD-EQCSEKLDACVSVFKAGVIQAQGCLES 69

  Fly    81 LYPN--GYC-------AAPCDRCNTSLCNRHVYPADRLRCYQCSGSDCIDVASRPQYL--LPCPV 134
            |..:  ..|       ...|:.|.|..||.  ..|.|..|.||:.::....|..|..|  :.||:
  Fly    70 LEDDWREKCEDKDKGNEIDCEICVTERCNN--VAAKRTSCIQCNNTEDAQCAESPGLLTAVQCPI 132

  Fly   135 YQED-DRCYTNVVHLSNTLRGCEHTNLPTTCPHVCLKCNYN-GCNAEKTVTELRCLQCTHNRLAP 197
            .:.. ..||.::|. .:..|||..|....      :||..: .|:....:.:..|          
  Fly   133 ARSGRSFCYASLVG-DDLKRGCSLTLSDQ------VKCLADPNCHLCDPLEQPHC---------- 180

  Fly   198 NPDCLRDQDPPAAVAEDQPKCSLSNST 224
            |...:|..|.|....|  |..|.|:||
  Fly   181 NDQIVRADDSPTTTQE--PTESTSSST 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15773NP_572251.1 DUF753 36..155 CDD:283175 35/131 (27%)
DUF753 287..438 CDD:283175
CG34040NP_001033963.1 DUF753 25..173 CDD:283175 42/161 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.