DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15773 and CG4377

DIOPT Version :9

Sequence 1:NP_572251.1 Gene:CG15773 / 31494 FlyBaseID:FBgn0029795 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_611614.1 Gene:CG4377 / 37489 FlyBaseID:FBgn0034664 Length:231 Species:Drosophila melanogaster


Alignment Length:276 Identity:59/276 - (21%)
Similarity:86/276 - (31%) Gaps:122/276 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DSLECYACDSAEDSECATRPGQQLEVEECQQTGDECVTSI-SAGLTRRGCLARLYPNGY--CAA- 89
            :|.:||:|   |...| :|..:|.....|....|.|||.. ...::.|||.:::...|.  ||| 
  Fly    33 ESPKCYSC---EGINC-SRTTRQNATVSCSDRLDVCVTIYEDFAVSERGCFSQISLAGQAKCAAK 93

  Fly    90 --PCDRCNTSLCNRHVYPADRLRCYQCSGSDCIDVASRPQYLLPCPVYQEDDRCYTNVVHLSNTL 152
              .|.:|:..||| :|...| .:|.||.|||..|                               
  Fly    94 DDQCQKCSGQLCN-NVGRRD-FKCIQCIGSDSAD------------------------------- 125

  Fly   153 RGCEHTNLPTTCPHVCLKCNYNGCNAEKTVTELRCLQCTHNRLAPNPDCLRDQDPPAAVAEDQPK 217
                              || .|..|....|:                                 
  Fly   126 ------------------CN-KGATASLAATQ--------------------------------- 138

  Fly   218 CSLSNSTVTHCVNKVMYGHRENCFSYRNTQTEVLQRGCSTAMGFYPTGELTECHGEFCNADCQDI 282
            |:|..|..::|..||:           ..|.:.|||||:.::     .|...|        .:|.
  Fly   139 CALPTSANSYCYVKVV-----------GDQKDSLQRGCALSV-----KEQKAC--------LEDS 179

  Fly   283 VCAAC---NSTANPGC 295
            .|:.|   ||:.:..|
  Fly   180 KCSLCLPENSSDSVAC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15773NP_572251.1 DUF753 36..155 CDD:283175 31/124 (25%)
DUF753 287..438 CDD:283175 4/12 (33%)
CG4377NP_611614.1 DUF753 36..184 CDD:283175 54/260 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455209
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.