DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15773 and CG13492

DIOPT Version :9

Sequence 1:NP_572251.1 Gene:CG15773 / 31494 FlyBaseID:FBgn0029795 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_726121.3 Gene:CG13492 / 37487 FlyBaseID:FBgn0034662 Length:2979 Species:Drosophila melanogaster


Alignment Length:485 Identity:132/485 - (27%)
Similarity:198/485 - (40%) Gaps:141/485 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LECYACDSAEDSECATRPGQQLEVEECQQTGDECVTSI--------SAGLTRRGCLARL--YPNG 85
            ::||.||:.:|..||....:  ...:||   .:|:|.:        ||.|..||||..|  ....
  Fly  1372 VDCYFCDAEDDVNCAWEKPE--STRKCQ---GQCMTGLYPRSSSWDSALLPTRGCLDDLNEAERT 1431

  Fly    86 YCAA----PCDRCNTSLCNRHVYPADRLRCYQCSGSDCIDVASRPQYLLPCPVYQEDDRCY---- 142
            .|||    .|..|..||||.....|:.|.||.|....|.|..:.     .|..|:|:|:||    
  Fly  1432 SCAAGTHSNCTACTGSLCNGEDVIANPLECYTCKDPFCEDPTTS-----KCVAYRENDQCYLAYD 1491

  Fly   143 -TNVVHLSNTLRGCEHTNLPTTCPHVCLKCNYNGCNAE-------KTVTELRCLQCTHNR----- 194
             :.||.:                          ||.:|       :.|.:.|.|.|:..:     
  Fly  1492 DSGVVAM--------------------------GCASEFEVQVIKELVAQQRLLLCSGQKCNEYS 1530

  Fly   195 LAPNPD-CLRDQDPPAAVAEDQPKCSLSNS--TVTHCVNKVMYGHRENCFSYRNTQTEVLQRGCS 256
            :.|:|: ||:      ..:.|.|:|:.:.:  |.|:..:::.|   ..|.:..::|...: |||.
  Fly  1531 ITPDPNTCLQ------CTSTDDPRCATNPNQLTTTNICSQIPY---TECVTQIDSQGNTI-RGCM 1585

  Fly   257 TAMG---FYP----TGELTE-CHGEFCN------ADCQDIVCAACNSTANPGCRAGRNLPTEKCA 307
            :::|   ||.    .|:|.| |.||.||      ||.:.  |..||||::|.|.|      ....
  Fly  1586 SSLGGDDFYECLTGDGKLCETCTGERCNGLSVFPADRRK--CYQCNSTSDPNCAA------SPAT 1642

  Fly   308 AGTTAC--YSCEQDTLVTHFPFIIPNTFLRRGCADA-DFAPAALGESCQLCRDADGCNRYSVR-- 367
            ..:|.|  ||.::..:.|     :.|....|||:.: ..:..:...:|::|..|||||..::.  
  Fly  1643 LESTVCPIYSQDESCVTT-----LLNGITHRGCSSSLTCSDPSDSRTCRVCSSADGCNTINLEKI 1702

  Fly   368 --------------SCYRCNAQDQDSDCAAMDLPTTMTTSNCSSPTELCVSTVVSRLDGIYTVRG 418
                          .|..|:.    :|||:    :..|.:.||. .:.|| ||.|. .|..|.||
  Fly  1703 GEDGFPGAWQDVPIECLVCSG----TDCAS----SGGTLTKCSG-YDNCV-TVFSD-SGSVTQRG 1756

  Fly   419 CEGQVPE----CSANDPYCVRCNGSLCNDA 444
            |...|.|    |..|..||.|||.:.||.|
  Fly  1757 CSESVFEESDYCDENPAYCPRCNSNGCNTA 1786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15773NP_572251.1 DUF753 36..155 CDD:283175 41/137 (30%)
DUF753 287..438 CDD:283175 49/173 (28%)
CG13492NP_726121.3 DUF753 112..263 CDD:283175
DUF753 281..428 CDD:283175
DUF753 368..520 CDD:283175
DUF753 537..674 CDD:283175
DUF753 700..844 CDD:283175
DUF753 871..>965 CDD:283175
DUF753 956..1104 CDD:283175
DUF753 1122..1266 CDD:283175
DUF753 1206..1336 CDD:283175
DUF753 1376..1523 CDD:283175 48/182 (26%)
DUF753 1540..1690 CDD:283175 43/172 (25%)
DUF753 1721..>1811 CDD:283175 29/77 (38%)
DUF753 1797..1948 CDD:283175
DUF753 1966..2110 CDD:283175
DUF753 2051..2191 CDD:283175
DUF753 2220..2368 CDD:283175
DUF753 2384..2530 CDD:283175
DUF753 2640..2769 CDD:283175
DUF753 2801..2943 CDD:283175
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D18141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.