DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15773 and CG10650

DIOPT Version :9

Sequence 1:NP_572251.1 Gene:CG15773 / 31494 FlyBaseID:FBgn0029795 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001286081.1 Gene:CG10650 / 35162 FlyBaseID:FBgn0046302 Length:425 Species:Drosophila melanogaster


Alignment Length:439 Identity:106/439 - (24%)
Similarity:148/439 - (33%) Gaps:135/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPLLALGGLIIMGLAIVDSLECYACDSA--EDSECATRPGQQLEVEECQQTGDECVTSISAGLTR 74
            |.::.:...|...|....:|:||:|.|.  :...|.|.|..|..: ||.   :||.|.|:||...
  Fly     6 LCMIVIAAFIASQLDSTSALQCYSCTSTTNDTGNCLTSPSTQTSI-ECD---NECYTLINAGTLT 66

  Fly    75 RGCLAR--------------------------------------------LYPNG---------- 85
            ||||..                                            :.||.          
  Fly    67 RGCLINGTACTLPSCSTCKEDNCNLNLVCQQCLGEANCATTNVTDTQYNAVCPNNGQVCVNQLND 131

  Fly    86 ----------YCAA----PCDRCNTSLCNRHVYPADRLRCYQCSGSDCIDVASRPQYLLPCPVYQ 136
                      .|||    .|..|:.||||..::||:|.:||.|||.:|..|::    .|.....|
  Fly   132 NKTVTRQCGDPCAAGTESTCSSCSASLCNVGLFPANRRQCYNCSGENCNAVSN----TLVAGCSQ 192

  Fly   137 EDDRCYTNVVHLSNTLRGCEHTNLPTTCPH-----VCLKCNYNGCNAEKTVTEL-RCLQCTHNRL 195
            .|..|:|.....||..|||........|..     .||.||.:.||:.....|. .|:.|     
  Fly   193 IDAGCFTTGTSASNMTRGCTSATTEIKCASDSTDPSCLVCNSDFCNSPTYEREAGSCIIC----- 252

  Fly   196 APNPDCLRDQDPPAAVAEDQPKCSLSNSTVTHCVNKVMYGHRENCFSYRNTQTEV-------LQR 253
               .:|...|     ||.:...|           .:..|.....|:: ..:.|.|       |:.
  Fly   253 ---ENCAEQQ-----VATNAKSC-----------GQAKYNQEVGCYT-MTSGTNVTRGCLNTLEA 297

  Fly   254 GCSTAMGFYPTGELTECHGEFCNADCQDIVCAACNSTANPGCRAGR---NLPTEKCAAGTTACYS 315
            ||||      |...|.|....||....:..|..|.|....||.:.:   .||...|..||  |||
  Fly   298 GCST------TNACTSCSENGCNVAAGEFQCITCISNEVSGCWSAKYPDTLPLINCPNGT--CYS 354

  Fly   316 CEQDTLVTHFPFIIPNTFLRRGC-ADADFAPAALGESCQLCRDADGCNR 363
            ...:.|.....|...:..::..| |..:      ...|:||.::. ||:
  Fly   355 GVWNELGVRGCFTAASHLMQYQCNAKVE------AHQCELCTESK-CNK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15773NP_572251.1 DUF753 36..155 CDD:283175 47/188 (25%)
DUF753 287..438 CDD:283175 21/81 (26%)
CG10650NP_001286081.1 DUF753 94..234 CDD:283175 35/143 (24%)
DUF753 170..309 CDD:283175 43/173 (25%)
DUF753 277..370 CDD:283175 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016902
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.