DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15773 and CG15347

DIOPT Version :9

Sequence 1:NP_572251.1 Gene:CG15773 / 31494 FlyBaseID:FBgn0029795 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001188562.1 Gene:CG15347 / 31779 FlyBaseID:FBgn0030040 Length:229 Species:Drosophila melanogaster


Alignment Length:166 Identity:50/166 - (30%)
Similarity:66/166 - (39%) Gaps:30/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CYACDSAEDSECATRPGQQLEVEECQQTGDECVTSISAGLTRRGCLARLYPNGYCAAPCDRCNTS 97
            |..|:|.::..|||.|...|. ..|......|.:.:..|.|.|||...| .|    |..:.||..
  Fly    37 CIQCNSKDNERCATDPLSLLN-RNCSDGSSNCYSRVLDGYTIRGCAVDL-DN----ATRNSCNNE 95

  Fly    98 L----------CNRHVYPADRLRCYQCSGSDCIDVASRPQYLLP--CPVYQEDDRCYTNVVHLSN 150
            |          |||:.:|..||.|.||:|:......:...|:..  ||:|:..|:||   :..||
  Fly    96 LLCQLCTYSEGCNRNTFPLSRLMCLQCTGNSTSSSCATETYVSAKICPLYKFGDKCY---IRNSN 157

  Fly   151 TL------RGC-EHTNLPTTC--PHVCLKCNYNGCN 177
            ..      ||| ...|....|  ...|..|...|||
  Fly   158 RTVDGSFQRGCLTSANARKQCVKDGNCYTCEGRGCN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15773NP_572251.1 DUF753 36..155 CDD:283175 40/136 (29%)
DUF753 287..438 CDD:283175
CG15347NP_001188562.1 DUF753 39..189 CDD:283175 46/158 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D25716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.