DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx27 and SNX25

DIOPT Version :9

Sequence 1:NP_727023.1 Gene:Snx27 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001364961.1 Gene:SNX25 / 83891 HGNCID:21883 Length:1037 Species:Homo sapiens


Alignment Length:275 Identity:57/275 - (20%)
Similarity:106/275 - (38%) Gaps:77/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 INGELYAPL------QHVSAVLEN----GAAEKAGIKKGD---------------RILEVNGV-- 112
            |..:||..|      :|.|.::.|    |..::||.:..|               ::.|:|..  
Human   589 IVSDLYEKLLIKEEEKHASQMISNKDEMGPRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLE 653

  Fly   113 -------SVEGA--THKQVVDLIKSGGDCLTLTVISVTQQEADRLEPQEDQSGYSYIDY--SDKR 166
                   |::.|  ..|::|..:|.       .:|.:.::..|.      |...:..|:  .:..
Human   654 YKRQALNSIQNAPKPDKKIVSKLKD-------EIILIEKERTDL------Q
LHMARTDWWCENLG 705

  Fly   167 SLPISIPDYGIVNRNGER----YIVFNIHMAG-----RQLCSRRYREFANLHSLLRKEFSGFNFP 222
            ....||....:...|||:    :::.::...|     .....||..||.|||..|.:........
Human   706 MWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKV 770

  Fly   223 KLP--GKWPFQLSEQQ-LDTRRRGLEQYLEKVCAVRVIAESDAVQDFLTDTEDDISASPVDIKVM 284
            :||  .|.||:..:|: ::..:..|.::|:.:.:...:.:|:|:..||       |.||..:||:
Human   771 QLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERLCQSEALYAFL-------SPS
PDYLKVI 828

  Fly   285 LPDHEVSTVSVKKSS 299
                   .|..||:|
Human   829 -------DVQGKKNS 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx27NP_727023.1 PDZ_signaling 46..138 CDD:238492 18/98 (18%)
PX_SNX27 165..270 CDD:132796 26/116 (22%)
UBQ 278..363 CDD:294102 7/22 (32%)
FERM-like_C_SNX27 428..528 CDD:270146
SNX25NP_001364961.1 PXA 166..321 CDD:396666
235kDa-fam <331..>691 CDD:130673 20/114 (18%)
RGS_SNX25 488..596 CDD:188675 3/6 (50%)
PX_SNX25 699..821 CDD:132788 27/128 (21%)
Nexin_C 898..1004 CDD:400794
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1370
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.