DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx27 and shank1

DIOPT Version :9

Sequence 1:NP_727023.1 Gene:Snx27 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_021327106.1 Gene:shank1 / 568908 ZFINID:ZDB-GENE-130530-691 Length:2469 Species:Danio rerio


Alignment Length:121 Identity:39/121 - (32%)
Similarity:63/121 - (52%) Gaps:9/121 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KTETGFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLENGAAEKAGIKKGDRILEVNGVSVEGA 117
            |...||||.:||..::...........:..||::.:|.|.|.|.:||::.||.::||||.:|...
Zfish   712 KDNEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKV 776

  Fly   118 THKQVVDLIKSGGDCLTLTVISVTQQEADRLEPQEDQSGYSYIDYSDKRSLPISIP 173
            .|:|||::|:.||:.|.:.|:.||:      .|..::.....|....||   :|.|
Zfish   777 GHRQVVNMIRQGGNSLMVKVV
MVTR------NPDMEEGVRKKIPQQSKR---LSTP 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx27NP_727023.1 PDZ_signaling 46..138 CDD:238492 30/84 (36%)
PX_SNX27 165..270 CDD:132796 4/9 (44%)
UBQ 278..363 CDD:294102
FERM-like_C_SNX27 428..528 CDD:270146
shank1XP_021327106.1 FERM_f0 151..234 CDD:318667
Ank_2 <258..>363 CDD:330894
ANK repeat 291..323 CDD:293786
ANK 320..446 CDD:238125
ANK repeat 325..356 CDD:293786
ANK repeat 358..423 CDD:293786
ANK 421..>481 CDD:238125
ANK repeat 425..456 CDD:293786
SH3_Shank 610..659 CDD:212766
PDZ_signaling 704..797 CDD:238492 30/84 (36%)
Atrophin-1 <2236..2376 CDD:331285
SAM_Shank1,2,3 2374..2439 CDD:188905
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.