DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx27 and snz

DIOPT Version :9

Sequence 1:NP_727023.1 Gene:Snx27 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster


Alignment Length:328 Identity:62/328 - (18%)
Similarity:107/328 - (32%) Gaps:109/328 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VGE-NHPLPTPTPASAVVTASSGGGGGGAVVMGVGVGVTTANGPR-------------------- 47
            :|: ..||....|.:|   ....||.|||    :.|...|:...|                    
  Fly   552 IGDVQEPLADEQPGAA---DGLNGGAGGA----IDVAAHTSYARRKLEQIQERIDKKNQALDALK 609

  Fly    48 --------VVTIYKTETGFGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLENGAAEKAGIKKGD 104
                    |:||.:.|..:             |:|...:..|.|:...|..|:....||.|:   
  Fly   610 YSVKPESKVLTILEKEMEW-------------LKSEKRQTEAHLRRTDAWTEHLGKWKATIQ--- 658

  Fly   105 RILEVNGVSVEGATHKQVVDLIKSGGDCLTLTVISVTQQEADRLEPQEDQSGYSYIDYSDKRSLP 169
                    |||.:..|:.:..         :.::.|.:.....::|...::|.|  .:::.|..|
  Fly   659 --------SVEVSDEKESLQF---------MILVHVDEDINAPVQPTSSKNGDS--GHANLRKRP 704

  Fly   170 ISIPDYGIVNRNGERYIVFNIHMAGRQLCSRRYREFANLHSLLRKEFSGFNFPKLPGKWPFQLSE 234
            ..|....:|.|:     :..:|               .|...||...|......||..:.|..  
  Fly   705 SGISSGWVVMRS-----LNQVH---------------ELQRKLRHVSSNLKAIDLPTNFKFFF-- 747

  Fly   235 QQLDTRRRG-------LEQYLEKVCAVRVIAESDAVQDFLTDTEDDISASPVDIKVMLPDHEVST 292
              |.|.|.|       ::::|..:.....:..|:|:..||:.:.|.:..|       ||..:.|.
  Fly   748 --LKTDRHGQEKAKSQIQKFLNFILEDDHLNGSEAIYTFLSPSSDHLKQS-------LPSPKKSK 803

  Fly   293 VSV 295
            .|:
  Fly   804 FSL 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx27NP_727023.1 PDZ_signaling 46..138 CDD:238492 18/119 (15%)
PX_SNX27 165..270 CDD:132796 22/111 (20%)
UBQ 278..363 CDD:294102 4/18 (22%)
FERM-like_C_SNX27 428..528 CDD:270146
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675
PX_SNX25 645..788 CDD:132788 35/188 (19%)
Nexin_C 882..987 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1370
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.