DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx27 and Snx14

DIOPT Version :9

Sequence 1:NP_727023.1 Gene:Snx27 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001346887.2 Gene:Snx14 / 244962 MGIID:2155664 Length:946 Species:Mus musculus


Alignment Length:329 Identity:71/329 - (21%)
Similarity:114/329 - (34%) Gaps:120/329 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QVSEGGQLRSINGE----LYAPLQHVSAVLEN------------------GA------------- 94
            :::||..:..:..:    |:...:||.::|||                  ||             
Mouse   421 RIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRNSKFNRGS 485

  Fly    95 ------------AEKAGIKK-GDRILEV-NGVSVEGATHKQVVDLIKSGGDCLTLTVISVTQQEA 145
                        .|..||.: |.:|..| ...::|||                .|....|.:.|.
Mouse   486 LSLDDFRSTQKRGESFGISRIGSKIKGVFKSTTMEGA----------------VLPNYGVAEGED 534

  Fly   146 DRLEP----QEDQS-------------------GYSYIDY-----SDKRSLPISIPDYGI-VNRN 181
            |.:|.    .||.|                   ...|:|:     |:::.....||.:.| |.||
Mouse   535 DFIEEGIVVMEDDSPVEAVSTPNTPRNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERN 599

  Fly   182 GERYIVFNIHMAGRQLCSRRYREFANLHSLLRKEFSGFNFP--KLPGK-------WPFQLSEQQL 237
            ..|.:.   |........|||.||..|.|.| .||.| .||  :||.|       :.|      |
Mouse   600 DRRAVG---HEPEHWSVYRRYLEFYVLESKL-TEFHG-TFPDAQLPSKRIIGPKNYEF------L 653

  Fly   238 DTRRRGLEQYLEKVCAVRVIAESDAVQDFLTDTEDDISASPVDIKVMLPDHEVSTVSVKKSSNAQ 302
            .::|...::||:|:.....::.|..:.|||:....:...    :..:|||  |:...:.||...:
Mouse   654 KSKREEFQEYLQKLVQHPELSNSQLLADFLSPNGGETQF----LDKILPD--VNLGKIIKSVPGK 712

  Fly   303 VVWE 306
            ::.|
Mouse   713 LMKE 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx27NP_727023.1 PDZ_signaling 46..138 CDD:238492 20/121 (17%)
PX_SNX27 165..270 CDD:132796 34/114 (30%)
UBQ 278..363 CDD:294102 7/29 (24%)
FERM-like_C_SNX27 428..528 CDD:270146
Snx14NP_001346887.2 PXA 130..299 CDD:308031
RGS_SNX14 340..466 CDD:188677 8/44 (18%)
PX_SNX14 564..686 CDD:132787 37/132 (28%)
Nexin_C 807..911 CDD:337134
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1370
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.