Sequence 1: | NP_727023.1 | Gene: | Snx27 / 31493 | FlyBaseID: | FBgn0052758 | Length: | 531 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001346887.2 | Gene: | Snx14 / 244962 | MGIID: | 2155664 | Length: | 946 | Species: | Mus musculus |
Alignment Length: | 329 | Identity: | 71/329 - (21%) |
---|---|---|---|
Similarity: | 114/329 - (34%) | Gaps: | 120/329 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 QVSEGGQLRSINGE----LYAPLQHVSAVLEN------------------GA------------- 94
Fly 95 ------------AEKAGIKK-GDRILEV-NGVSVEGATHKQVVDLIKSGGDCLTLTVISVTQQEA 145
Fly 146 DRLEP----QEDQS-------------------GYSYIDY-----SDKRSLPISIPDYGI-VNRN 181
Fly 182 GERYIVFNIHMAGRQLCSRRYREFANLHSLLRKEFSGFNFP--KLPGK-------WPFQLSEQQL 237
Fly 238 DTRRRGLEQYLEKVCAVRVIAESDAVQDFLTDTEDDISASPVDIKVMLPDHEVSTVSVKKSSNAQ 302
Fly 303 VVWE 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Snx27 | NP_727023.1 | PDZ_signaling | 46..138 | CDD:238492 | 20/121 (17%) |
PX_SNX27 | 165..270 | CDD:132796 | 34/114 (30%) | ||
UBQ | 278..363 | CDD:294102 | 7/29 (24%) | ||
FERM-like_C_SNX27 | 428..528 | CDD:270146 | |||
Snx14 | NP_001346887.2 | PXA | 130..299 | CDD:308031 | |
RGS_SNX14 | 340..466 | CDD:188677 | 8/44 (18%) | ||
PX_SNX14 | 564..686 | CDD:132787 | 37/132 (28%) | ||
Nexin_C | 807..911 | CDD:337134 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1370 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |