DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Snx27 and Snx13

DIOPT Version :9

Sequence 1:	NP_727023.1	Gene:	Snx27 / 31493	FlyBaseID:	FBgn0052758	Length:	531	Species:	Drosophila melanogaster
Sequence 2:	XP_006515125.3	Gene:	Snx13 / 217463	MGIID:	2661416	Length:	1144	Species:	Mus musculus

Alignment Length:	142	Identity:	38/142 - (26%)
Similarity:	66/142 - (46%)	Gaps:	22/142 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   139 SVTQQEADRLEPQEDQSGYSYIDYSDKRSLPISIPDYGIVNRNGERYIVFNIHMAGRQLCS---- 199
            |||..::.:|......:.|:  ||.     |.::.  |:.|.:|:.|.::.|.:..|.|.:
Mouse   728 SVTSDDSVQLHAYISDTVYA--DYD-----PYAVA--GVCNDHGKTYALYAITVHRRNLNTEEMW 783

  Fly   200 ---RRYREFANLHSLLRKEFSGF-NFPKLPGKWPF-QLSEQQLDTRRRGLEQYLEKVCAVRVIAE 259
               |||.:|.:.|..:.::|... :..|||||..| .:....|:.|::.|..||:.:....::..
Mouse   784 KTYRRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMMKA 848

  Fly   260 SDA----VQDFL 267
            |.|    |.|||
Mouse   849 SPALAHCVYDFL 860

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Snx27	NP_727023.1	PDZ_signaling	46..138	CDD:238492
		PX_SNX27	165..270	CDD:132796	31/116 (27%)
		UBQ	278..363	CDD:294102
		FERM-like_C_SNX27	428..528	CDD:270146
Snx13	XP_006515125.3	PHA03381	6..>146	CDD:177618
		PXA	273..460	CDD:214611
		RGS_SNX13	553..687	CDD:188674
		PX_SNX13	733..863	CDD:132783	35/137 (26%)
		Nexin_C	979..1087	CDD:370015
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R1370
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030