DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx27 and snx-14

DIOPT Version :9

Sequence 1:NP_727023.1 Gene:Snx27 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_496844.3 Gene:snx-14 / 174997 WormBaseID:WBGene00013011 Length:971 Species:Caenorhabditis elegans


Alignment Length:228 Identity:52/228 - (22%)
Similarity:82/228 - (35%) Gaps:66/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LTVISVTQQEADRLEPQEDQSG----YSYI-----------DYSDKRSLPIS---IPD------- 174
            ||.:|..::|...:|..|.|.|    .||:           |..::||.|..   ||.       
 Worm   519 LTSVSDEEKEEAGVETPESQGGSSTASSYVNIAAPSIDVIEDVEEERSEPAEEAPIPKTTGLVID 583

  Fly   175 -----------------YGIVNRNGERYI-VFNI---------HMAGRQLCSRRYREFANLHSLL 212
                             .|:.::..:|.| ||.|         |...|....|.:.||..|.|.|
 Worm   584 SEPPINLNCWKVNVAQVNGLRDKISDRVIFVFIIEVERPDAKPHETQRWSIHRSFNEFYVLESKL 648

  Fly   213 RKEFSG--FNFPKLPGKWPFQLSEQQ-LDTRRRGLEQYLEKVCAVRVIAESDAVQDFLTDTE--- 271
             .||.|  ..|..||.:..|...::. ::..|.....:|..:...|::..|:.:..||:..|   
 Worm   649 -NEFHGDSLRFSPLPTRKTFVTRDKPFMEQHRLIFSTFLSTLSKQRILNRSELLLAFLSSNEEFR 712

  Fly   272 DDISASPVD----IKVMLPDHEVSTVSVKKSSN 300
            |.:|...::    :|..||.   ..|:.:|..|
 Worm   713 DTLSLGDLNPWKVVKKTLPG---KLVNREKGQN 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx27NP_727023.1 PDZ_signaling 46..138 CDD:238492 2/2 (100%)
PX_SNX27 165..270 CDD:132796 32/144 (22%)
UBQ 278..363 CDD:294102 6/27 (22%)
FERM-like_C_SNX27 428..528 CDD:270146
snx-14NP_496844.3 PXA 112..314 CDD:383027
RGS 352..475 CDD:214613
PX_SNX14 591..708 CDD:132787 27/117 (23%)
Nexin_C 856..941 CDD:370015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1370
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.