DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx27 and Snx25

DIOPT Version :9

Sequence 1:NP_727023.1 Gene:Snx27 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001359271.1 Gene:Snx25 / 102141 MGIID:2142610 Length:986 Species:Mus musculus


Alignment Length:309 Identity:68/309 - (22%)
Similarity:102/309 - (33%) Gaps:88/309 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ENHPLPTPTPASAVVTASSGGGGGGAVVMGVGVGVTTANGPRVVTIYKTETGFGFNVRGQVSEGG 70
            |....|....||......|||..|...|.|.. ||   :.|....:.|                 
Mouse   550 EEEEEPDAQLASEKDELGSGGEAGEEAVEGTS-GV---SDPASFAVIK----------------- 593

  Fly    71 QLRSINGELYAPLQHVSAVLENGAAEKAGIKK-GDRILEVNGVSVEGATHKQVVDLIKSGGDC-- 132
             ||.:|.:|....|.:|::......:|..|.| .|.||.:.........|     :.::...|  
Mouse   594 -LRELNEKLEYKRQALSSIQNAPKPDKKIISKLKDEILLIEKECTALQLH-----MARTDWWCEN 652

  Fly   133 LTLTVISVTQQEADRLEPQEDQSGYSYIDYSDKRSLPISIPDYGIVNRNGER----YIVFNIHMA 193
            |.|...|:|..|                                :...|||:    ::..|:...
Mouse   653 LGLWRASITSAE--------------------------------VTEENGEQMPCYFVRVNLQEV 685

  Fly   194 G-----RQLCSRRYREFANLHSLLRKEFSGFNFPKLP--GKWPFQ-LSEQQLDTRRRGLEQYLEK 250
            |     .....||..||.|||..|.:........:||  .|.||: :..:.|...|..|..:|:.
Mouse   686 GGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKFLGKSRNQLNAFLQN 750

  Fly   251 VCAVRVIAESDAVQDFLTDTEDDISASPVDIKVMLPDHEVSTVSVKKSS 299
            :.:...:.:|:|:..||       |.||..:||:       .|..||:|
Mouse   751 LLSDERLFQSEALYAFL-------SPSPDYLKVI-------DVQGKKTS 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx27NP_727023.1 PDZ_signaling 46..138 CDD:238492 18/94 (19%)
PX_SNX27 165..270 CDD:132796 26/116 (22%)
UBQ 278..363 CDD:294102 7/22 (32%)
FERM-like_C_SNX27 428..528 CDD:270146
Snx25NP_001359271.1 PXA 148..303 CDD:366970
RGS 437..545 CDD:383028
End3 <558..645 CDD:372297 25/113 (22%)
PX_SNX25 648..770 CDD:132788 33/160 (21%)
Nexin_C 847..950 CDD:370015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1370
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.