DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33080 and D2096.12

DIOPT Version :9

Sequence 1:NP_788858.1 Gene:CG33080 / 31491 FlyBaseID:FBgn0053080 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_001023103.1 Gene:D2096.12 / 3565193 WormBaseID:WBGene00017079 Length:763 Species:Caenorhabditis elegans


Alignment Length:268 Identity:52/268 - (19%)
Similarity:83/268 - (30%) Gaps:94/268 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DERLEEHGQEQEQLQLLGAMPRKQSLSERRNVDLPHLK----------------MVNEKEPESAT 78
            |.:.:.|.:|:|.|:.|.|   |..:.|::..||..:|                .|.:..|.:..
 Worm   241 DFQKDVHKKEEEHLRHLAA---KDLIIEKQKKDLEMMKSSIACRKSEIYSTPKTTVTQNFPTNRQ 302

  Fly    79 PSPEAFAPGLR------------------------RNSISMPSGINALDLEALRLRHQMQPQDAL 119
            .|....:|.|.                        |:.:|: ..|:.       .||..:..|  
 Worm   303 SSTAMISPSLHPIPEIKKIYPKIPSTEHKSFKTPPRHPVSL-GNISV-------FRHPFKEND-- 357

  Fly   120 HEEIIADDATSSLGTPATPDTPGTTAPTTTANTPDKAINFANDDSDDEFGNA-----RRPVHRDR 179
             |:....|.:......:||...|  .|.|....|   ::.....|.:|....     |:||.|..
 Worm   358 -EDTFQVDTSFEPSATSTPKFTG--IPRTGLRRP---LDLGEAGSSNEHNRGAPTPKRKPVFRKE 416

  Fly   180 FRSRRRASIAPLPALRLNSKEMLASDFD----SHSLASNQASITSVNSLASLLREKMQAFPQLIR 240
            .:.|....|          :|.|...::    .||: |.|.|               |.||....
 Worm   417 RKKRTHEEI----------QEELRKIWEEIGIKHSM-SGQVS---------------QFFPPKSV 455

  Fly   241 KKKRETKD 248
            ||..|.::
 Worm   456 KKDEENEE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33080NP_788858.1 GH31_NET37 511..888 CDD:269878
D2096.12NP_001023103.1 MCU 216..>284 CDD:309702 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.