Sequence 1: | NP_572247.2 | Gene: | AdamTS-B / 31490 | FlyBaseID: | FBgn0029791 | Length: | 1023 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017211532.2 | Gene: | adamtsl7 / 556634 | ZFINID: | ZDB-GENE-070816-2 | Length: | 643 | Species: | Danio rerio |
Alignment Length: | 396 | Identity: | 97/396 - (24%) |
---|---|---|---|
Similarity: | 141/396 - (35%) | Gaps: | 143/396 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 744 GCDWIVDSEVQDDRCGVCGGSGDQCQPVRET-YTDPFAAKDGAYVEIVTIPARARHILIRELANS 807
Fly 808 PHFLAI--ATGDGGDRFYLNGDSLISMPGEFEIAGAESLYDRVDE-----QETITIPQPIQHSIS 865
Fly 866 LYAIVRGNESNAGIFYEFTLPALNVT--------------------------AGRQ--------- 895
Fly 896 -------------FQWRLSNWTACSASCGGGVQHREPI--CQENG---KALGDTLPCWTHAKNKR 942
Fly 943 PARQSRGCGDQPCPAHWWPGPWQFCPVTCRPVGF------------------------------- 976
Fly 977 -----------------------VAPP----QRRRSVVCLDEHDVVVADAECGHLQKPAEMEPCE 1014
Fly 1015 SSLPIC 1020 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
AdamTS-B | NP_572247.2 | Pep_M12B_propep | 78..194 | CDD:279848 | |
ZnMc_ADAMTS_like | 314..518 | CDD:239801 | |||
Reprolysin | 315..521 | CDD:279729 | |||
ADAM_CR | <558..602 | CDD:301627 | |||
TSP1 | 614..666 | CDD:214559 | |||
ADAM_spacer1 | 773..886 | CDD:283607 | 36/120 (30%) | ||
TSP1 | 901..956 | CDD:214559 | 18/59 (31%) | ||
adamtsl7 | XP_017211532.2 | ADAM_spacer1 | 82..183 | CDD:310520 | 35/106 (33%) |
TSP1 | 302..>335 | CDD:214559 | 9/33 (27%) | ||
TSP1 | 361..418 | CDD:214559 | 14/58 (24%) | ||
TSP1 | 542..593 | CDD:214559 | |||
PLAC | 601..631 | CDD:312271 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3538 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |