DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-B and paplnb

DIOPT Version :9

Sequence 1:NP_572247.2 Gene:AdamTS-B / 31490 FlyBaseID:FBgn0029791 Length:1023 Species:Drosophila melanogaster
Sequence 2:NP_001018400.1 Gene:paplnb / 553586 ZFINID:ZDB-GENE-030131-6023 Length:548 Species:Danio rerio


Alignment Length:408 Identity:96/408 - (23%)
Similarity:149/408 - (36%) Gaps:136/408 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 WGDWSEWSECSRSCGGGVSTQQRECDNPVPANGGVFCIGERKRYKICRKRPCPAEEPSFRAQQCA 678
            :|::..:..|||:|||||:.:.|.| |.:..:||..|:|..|.||:|..:.|||....||.:||:
Zfish    27 YGEYGPYGPCSRTCGGGVAVRTRIC-NTMRTDGGHNCVGPSKSYKLCNTQECPAGSRDFREEQCS 90

  Fly   679 RFDNVSYQGATYKWLPFFDKNNPCKLFCSDVDDTIIANWGATVLDGTPCTLGTNNMCIDGICKKV 743
            .||.:::||..|.|.|::..:|||:|.|....:.........|:|||.|.:|..::|::|:|:.|
Zfish    91 HFDQMTFQGKRYTWQPYYGASNPCELVCVPRGENFYYRHRPAVVDGTLCHVGRRDVCVEGVCRAV 155

  Fly   744 GCDWIVDSEVQDDRCGVCGGSGDQCQPVRETYTDPFAAKDGAYVEIVTIPARARHILIRELANSP 808
            ....||..|.:|                                    ||..:||          
Zfish   156 SHGEIVGFEDRD------------------------------------IPVTSRH---------- 174

  Fly   809 HFLAIATGDGGDRFYLNGDSLISMPGEFEIAGAESLYDRVDEQETITIPQPIQHSISLYAIVRGN 873
                   |.|                                                       
Zfish   175 -------GPG------------------------------------------------------- 177

  Fly   874 ESNAGIFYEFTLPALNVTAGRQFQWRLSNWTACSASCGGGVQHREPIC-QENGKALGDTLPCWTH 937
               |.:..:            .:::..|.::.||..||||||.|...| .|...|:.|...|  .
Zfish   178 ---AAVHLD------------TYRYTYSAYSECSRLCGGGVQSRTVYCVHERTSAMVDESHC--I 225

  Fly   938 AKNKRPARQSRGCGDQPCPAHWWPGPWQFCPVTCRPVGFVAPPQRRRSVVCLDEHDVVVADAECG 1002
            ||..|.......|.:..| |.:..||:..|.|||      ....:.|.|:|:......:::..|.
Zfish   226 AKGLRKPTAQVACNEHAC-AEYSAGPFGDCSVTC------GEGLQTREVICVGGRGERLSEHHCS 283

  Fly  1003 HLQKPAEMEPCESSLPIC 1020
            .|.:|.:.:.|:.  |.|
Zfish   284 GLTRPQDTKACKR--PAC 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-BNP_572247.2 Pep_M12B_propep 78..194 CDD:279848
ZnMc_ADAMTS_like 314..518 CDD:239801
Reprolysin 315..521 CDD:279729
ADAM_CR <558..602 CDD:301627
TSP1 614..666 CDD:214559 20/51 (39%)
ADAM_spacer1 773..886 CDD:283607 7/112 (6%)
TSP1 901..956 CDD:214559 19/55 (35%)
paplnbNP_001018400.1 TSP1 28..78 CDD:214559 20/50 (40%)
TSP1 249..300 CDD:214559 15/59 (25%)
TSP1 309..359 CDD:214559
Kunitz_BPTI 470..522 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.