powered by:
Protein Alignment AdamTS-B and CG31609
DIOPT Version :9
Sequence 1: | NP_572247.2 |
Gene: | AdamTS-B / 31490 |
FlyBaseID: | FBgn0029791 |
Length: | 1023 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_723444.2 |
Gene: | CG31609 / 318845 |
FlyBaseID: | FBgn0051609 |
Length: | 123 |
Species: | Drosophila melanogaster |
Alignment Length: | 45 |
Identity: | 14/45 - (31%) |
Similarity: | 19/45 - (42%) |
Gaps: | 7/45 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 949 GCGDQPCPAHWWPGPWQFCPVTCRPVGFVAPPQRRRSVVCLDEHD 993
|||..|...: ..:.|..||| ...||.|::....|||.:
Fly 63 GCGGNPNRFY----TKEECLKTCR---VYRPPNRKKREENLDEEE 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3538 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.