DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-B and CG31609

DIOPT Version :9

Sequence 1:NP_572247.2 Gene:AdamTS-B / 31490 FlyBaseID:FBgn0029791 Length:1023 Species:Drosophila melanogaster
Sequence 2:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster


Alignment Length:45 Identity:14/45 - (31%)
Similarity:19/45 - (42%) Gaps:7/45 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   949 GCGDQPCPAHWWPGPWQFCPVTCRPVGFVAPPQRRRSVVCLDEHD 993
            |||..|...:    ..:.|..|||   ...||.|::....|||.:
  Fly    63 GCGGNPNRFY----TKEECLKTCR---VYRPPNRKKREENLDEEE 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-BNP_572247.2 Pep_M12B_propep 78..194 CDD:279848
ZnMc_ADAMTS_like 314..518 CDD:239801
Reprolysin 315..521 CDD:279729
ADAM_CR <558..602 CDD:301627
TSP1 614..666 CDD:214559
ADAM_spacer1 773..886 CDD:283607
TSP1 901..956 CDD:214559 4/6 (67%)
CG31609NP_723444.2 KU 35..82 CDD:238057 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.