DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-B and Adamtsl3

DIOPT Version :9

Sequence 1:NP_572247.2 Gene:AdamTS-B / 31490 FlyBaseID:FBgn0029791 Length:1023 Species:Drosophila melanogaster
Sequence 2:NP_001101003.2 Gene:Adamtsl3 / 308787 RGDID:1305155 Length:1705 Species:Rattus norvegicus


Alignment Length:434 Identity:128/434 - (29%)
Similarity:197/434 - (45%) Gaps:65/434 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 NGGWGDWSEWSECSRSCGGGVSTQQRECDNPVPANGGVFCIGERKRYKICRKRPCPAEEPSFRAQ 675
            :|.|..|.:||:|||:||||.|...|.|..      |..|.|:..|||.|....|||:...||||
  Rat    87 DGNWDAWGDWSDCSRTCGGGASYSLRRCLT------GRNCEGQNIRYKTCSNHDCPADAEDFRAQ 145

  Fly   676 QCARFDNVSYQGATYKWLPFF-DKNNPCKLFCSDVDDTIIANWGATVLDGTPCTLGTNNMCIDGI 739
            ||:.:::|.|||..|:|:|.. |...||.|.|.....:::......|||||.|...|.:|||.||
  Rat   146 QCSAYNDVQYQGHYYEWIPLHNDPAAPCALKCHARGQSLVVELAPKVLDGTRCNADTLDMCISGI 210

  Fly   740 CKKVGCDWIVDSEVQDDRCGVCGGSGDQCQPVR---ETYTDPFAAKDGAYVEIVTIPARARHILI 801
            |:.||||..:.|..:.|.||||.|.|..|:.||   :.:..|...::    .::.:|..:|.:.|
  Rat   211 CQTVGCDRQLGSSAKKDNCGVCAGDGSTCRLVRGQTKVHLSPEKKEE----NVIAVPLGSRSVRI 271

  Fly   802 RELANSPHFLAIATGDGGDRFYLNGDSLISMPGEFEIAGAESLYDRVDEQETITIPQPIQHSI-- 864
            .....:..|:...|..|.     .|:...:.||.|.:......:.:..:::|..|..|:....  
  Rat   272 TVKGPALLFIESKTLQGS-----RGEHSFNSPGVFVVENTTIEFQKGADRQTFKIAGPLMADFIF 331

  Fly   865 -SLYAIVRGNESNAGIFYEFTLPALNVTAGRQFQWRLSNWTACSASCGGGVQHREPICQENGKAL 928
             :.|.:.:|:.    :.:.|..|.       ..|||.:::..|:.:||||.|.....|.:  ..|
  Rat   332 KTRYTVAKGSV----VQFFFYQPI-------SHQWRQTDFFPCTVTCGGGYQLNSAECMD--IRL 383

  Fly   929 GDTLP---CWTHAKNKRPARQSRGCGDQPCPA-----------------HWWPGPWQFCPVTCRP 973
            ...:|   |..:.:|.:|..:.:.|...|||:                 .|...||..|.|:|. 
  Rat   384 KRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCG- 447

  Fly   974 VGFVAPPQRRRSVVCLDE--HDVV--VADAECGHLQKPAEMEPC 1013
             |.:    :|||.||::|  |..:  |.:.:|.:..||..|:.|
  Rat   448 -GGI----QRRSFVCVEESMHAEILQVEEWKCMYAPKPKVMQTC 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-BNP_572247.2 Pep_M12B_propep 78..194 CDD:279848
ZnMc_ADAMTS_like 314..518 CDD:239801
Reprolysin 315..521 CDD:279729
ADAM_CR <558..602 CDD:301627
TSP1 614..666 CDD:214559 21/51 (41%)
ADAM_spacer1 773..886 CDD:283607 17/115 (15%)
TSP1 901..956 CDD:214559 14/57 (25%)
Adamtsl3NP_001101003.2 TSP1 90..136 CDD:214559 21/51 (41%)
TSP1 438..>458 CDD:214559 10/25 (40%)
TSP1 498..>527 CDD:214559
TSP1 583..>603 CDD:214559
TSP1 720..773 CDD:214559
TSP1 839..894 CDD:214559
Ig 942..1006 CDD:299845
Ig 1223..1291 CDD:143165
IG_like 1313..1392 CDD:214653
IGc2 1329..1387 CDD:197706
TSP_1 1502..1557 CDD:278517
PLAC 1673..1703 CDD:285849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.