DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-B and adamtsl5

DIOPT Version :9

Sequence 1:NP_572247.2 Gene:AdamTS-B / 31490 FlyBaseID:FBgn0029791 Length:1023 Species:Drosophila melanogaster
Sequence 2:XP_005166548.1 Gene:adamtsl5 / 101886605 ZFINID:ZDB-GENE-161017-76 Length:538 Species:Danio rerio


Alignment Length:304 Identity:112/304 - (36%)
Similarity:154/304 - (50%) Gaps:36/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 RREELAAVNGG--------------WGDWSEWSECSRSCGGGVSTQQREC--DNPVPANGGVFCI 651
            ||.||    ||              |..|..||.||||||||.|.:.|.|  .|.|   ||. |.
Zfish    34 RRVEL----GGEGLQMRSQMHFMNEWASWGGWSVCSRSCGGGASVRTRTCMTRNLV---GGP-CP 90

  Fly   652 GERKRYKICRKRPCPAEEPSFRAQQCARF-DNVSYQGATYKWLPFFDKNNPCKLFCSDVDDTIIA 715
            |:.::||||..:.|||:...||..||..| |.....|:::.|..|...::||:|.|..:......
Zfish    91 GDTRQYKICNSKECPADSMDFRELQCKAFNDRPLVAGSSFHWTTFHGGSDPCELSCLAIGHNFYY 155

  Fly   716 NWGATVLDGTPCTLGTNNMCIDGICKKVGCDWIVDSEVQDDRCGVCGGSGDQCQPVRETYTDPFA 780
            |:| .|||||||......:|::|.|.|.|||.|..|:.|:|.|.||||....|...|..|... .
Zfish   156 NFG-RVLDGTPCQSDQGTVCVNGKCLKPGCDLIFGSQQQEDACMVCGGHNSTCLHHRSVYQSN-G 218

  Fly   781 AKDG--AYVEIVTIPARARHILIRELANSPHFLAIATGDGGDRFYLNGDSLISMPGEFEIAGAES 843
            ..:|  .|.|:..|||.|.||.:.:  ||.::||:.  :|..:|.:||:..|::|||:.:||.:.
Zfish   219 QNNGLFGYSEVTMIPAGATHIRVTD--NSRNYLALQ--NGHSQFVINGNWKINVPGEYSVAGTKL 279

  Fly   844 LYDR-VDEQETITIPQPIQHSISLYAIVRGNESNAGIFYEFTLP 886
            .|.| .|..|:..:..|.|.  .|:.:|...:..:||.||:.||
Zfish   280 QYRRSADTWESFEVSGPTQE--DLHIMVLSTDKKSGIEYEYWLP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-BNP_572247.2 Pep_M12B_propep 78..194 CDD:279848
ZnMc_ADAMTS_like 314..518 CDD:239801
Reprolysin 315..521 CDD:279729
ADAM_CR <558..602 CDD:301627
TSP1 614..666 CDD:214559 25/53 (47%)
ADAM_spacer1 773..886 CDD:283607 36/115 (31%)
TSP1 901..956 CDD:214559
adamtsl5XP_005166548.1 TSP1 55..105 CDD:214559 25/53 (47%)
ADAM_spacer1 219..321 CDD:283607 35/107 (33%)
NTR 426..519 CDD:280015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.