Sequence 1: | NP_572247.2 | Gene: | AdamTS-B / 31490 | FlyBaseID: | FBgn0029791 | Length: | 1023 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005174675.1 | Gene: | LOC101885599 / 101885599 | -ID: | - | Length: | 194 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 87/196 - (44%) |
---|---|---|---|
Similarity: | 121/196 - (61%) | Gaps: | 5/196 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 318 LIVADATMSAFH-RDLNGYLLTIMNMVSALYKDPSIGNSIEIVVVRIIQLDEEESQLQLNLTQNA 381
Fly 382 QKNLDRFCSWQHKLNKGSEKDPHHHDVAILITRKNIC--ANNCMTLGLANVGGMCKPKQSCSVNE 444
Fly 445 DNGIMLSHTITHELGHNFGMFHDTAKIGCHPRVGPIVHIMTPTFGADTLQVCWSNCSRKYITHFL 509
Fly 510 D 510 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
AdamTS-B | NP_572247.2 | Pep_M12B_propep | 78..194 | CDD:279848 | |
ZnMc_ADAMTS_like | 314..518 | CDD:239801 | 87/196 (44%) | ||
Reprolysin | 315..521 | CDD:279729 | 87/196 (44%) | ||
ADAM_CR | <558..602 | CDD:301627 | |||
TSP1 | 614..666 | CDD:214559 | |||
ADAM_spacer1 | 773..886 | CDD:283607 | |||
TSP1 | 901..956 | CDD:214559 | |||
LOC101885599 | XP_005174675.1 | Reprolysin | 1..194 | CDD:279729 | 86/194 (44%) |
ZnMc_ADAMTS_like | 1..194 | CDD:239801 | 86/194 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D125522at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |