DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-B and LOC101885599

DIOPT Version :9

Sequence 1:NP_572247.2 Gene:AdamTS-B / 31490 FlyBaseID:FBgn0029791 Length:1023 Species:Drosophila melanogaster
Sequence 2:XP_005174675.1 Gene:LOC101885599 / 101885599 -ID:- Length:194 Species:Danio rerio


Alignment Length:196 Identity:87/196 - (44%)
Similarity:121/196 - (61%) Gaps:5/196 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 LIVADATMSAFH-RDLNGYLLTIMNMVSALYKDPSIGNSIEIVVVRIIQLDEEESQLQLNLTQNA 381
            ::.||..|...| .:|..|:||||::|:::|:|||:||.|.|::|::|.:..|:....::|.  |
Zfish     1 MVTADVKMLKHHGANLEHYILTIMSVVASIYRDPSVGNLINIMIVKLIVIHNEQEGPNVSLL--A 63

  Fly   382 QKNLDRFCSWQHKLNKGSEKDPHHHDVAILITRKNIC--ANNCMTLGLANVGGMCKPKQSCSVNE 444
            ...|..||.||...|...:.||.|||.|:||||::||  .:.|.|||||.:|.||.|.:|||::|
Zfish    64 TSTLHNFCVWQQSQNSADDSDPSHHDTALLITREDICRAKDKCDTLGLAELGTMCDPYRSCSISE 128

  Fly   445 DNGIMLSHTITHELGHNFGMFHDTAKIGCHPRVGPIVHIMTPTFGADTLQVCWSNCSRKYITHFL 509
            :||:..|.||.|||||.|.|.||.:.......:....|:|.||...||....||.|||||||.||
Zfish   129 ENGLSASFTIAHELGHVFNMPHDDSPKCREAGIKHQYHVMAPTLNYDTSPWSWSKCSRKYITEFL 193

  Fly   510 D 510
            :
Zfish   194 E 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-BNP_572247.2 Pep_M12B_propep 78..194 CDD:279848
ZnMc_ADAMTS_like 314..518 CDD:239801 87/196 (44%)
Reprolysin 315..521 CDD:279729 87/196 (44%)
ADAM_CR <558..602 CDD:301627
TSP1 614..666 CDD:214559
ADAM_spacer1 773..886 CDD:283607
TSP1 901..956 CDD:214559
LOC101885599XP_005174675.1 Reprolysin 1..194 CDD:279729 86/194 (44%)
ZnMc_ADAMTS_like 1..194 CDD:239801 86/194 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125522at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.