DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB3 and CG46428

DIOPT Version :10

Sequence 1:NP_001427702.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:222 Species:Homo sapiens
Sequence 2:NP_001369095.1 Gene:CG46428 / 54520436 FlyBaseID:FBgn0286931 Length:93 Species:Drosophila melanogaster


Alignment Length:77 Identity:17/77 - (22%)
Similarity:30/77 - (38%) Gaps:27/77 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    16 FDKMEVRMAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKS 80
            ||...:.:.|.|                .|   |.|     |::.|   |....:|:.|:..:||
  Fly    16 FDHFRINLQKRD----------------IC---HLK-----PISLA---KIAGRKWREMTTAQKS 53

Human    81 KFDEMAKADKVR 92
            .|.::|:.::.|
  Fly    54 VFVQIAEINRAR 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMGB3NP_001427702.1 None
CG46428NP_001369095.1 HMG-box_SF 10..65 CDD:438789 16/75 (21%)

Return to query results.
Submit another query.