DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB3 and cic

DIOPT Version :10

Sequence 1:NP_001427702.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:222 Species:Homo sapiens
Sequence 2:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster


Alignment Length:157 Identity:34/157 - (21%)
Similarity:62/157 - (39%) Gaps:21/157 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    73 TMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAP-KRPPSGFFLFCSEFRPKIKST 136
            |.:.|.:|:     ....::..::.:....|.|....:..|.. :||.:.|.:|..:.|..:...
  Fly  1194 TSAAKRRSQ-----SLSALQQQQQQQQQAGAAGTAAGQPANKKIRRPMNAFMIFSKKHRKMVHKK 1253

Human   137 NPGISIGDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYK--SK-------------G 186
            :|......|:|.|||.|..|...:|..|...|:.:|:.:.|...::|  ||             |
  Fly  1254 HPNQDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKLHPEWKWCSKDRRKSSTSTATPGG 1318

Human   187 KFDGAKGPAKVARKKVEEEDEEEEEEE 213
            |..||.|.....::.|..:..:..|.:
  Fly  1319 KASGAAGTGDAKQRLVSVDGSDSLEHD 1345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMGB3NP_001427702.1 None
cicNP_001262755.1 DUF4819 349..432 CDD:465014
HMG-box_CIC-like 1231..1308 CDD:438806 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.