DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB3 and tHMG1

DIOPT Version :10

Sequence 1:NP_001427702.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:222 Species:Homo sapiens
Sequence 2:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster


Alignment Length:68 Identity:25/68 - (36%)
Similarity:38/68 - (55%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   115 PKRPPSGFFLFC-SEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEK----QPYITKAAKLKEK 174
            ||:|.|.|.|:. |..|..||:.:|..|:.:|:.|.||||..:.|.:|    :...|..|:.|||
  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72

Human   175 YEK 177
            .::
  Fly    73 LKQ 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMGB3NP_001427702.1 None
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 25/68 (37%)

Return to query results.
Submit another query.