DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB3 and Sox21b

DIOPT Version :10

Sequence 1:NP_001427702.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:222 Species:Homo sapiens
Sequence 2:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster


Alignment Length:76 Identity:25/76 - (32%)
Similarity:44/76 - (57%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   108 KKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQPYITKAAKLK 172
            |:::....|||.:.|.::....|.||...||.:...:::|:||..|..|.:.||:|:|.:|.:|:
  Fly   241 KRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLR 305

Human   173 EKYEKDVADYK 183
            ..:.|:..|||
  Fly   306 AMHMKEHPDYK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMGB3NP_001427702.1 None
Sox21bNP_001261829.1 HMG-box_SoxB 246..325 CDD:438790 24/71 (34%)

Return to query results.
Submit another query.