DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB3 and Sox21a

DIOPT Version :10

Sequence 1:NP_001427702.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:222 Species:Homo sapiens
Sequence 2:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster


Alignment Length:68 Identity:22/68 - (32%)
Similarity:40/68 - (58%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   116 KRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVA 180
            |||.:.|.::....|.|:...||.:...:::|:||..|..|.:.:|:|:|.:|.:|:..:.|:..
  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHP 186

Human   181 DYK 183
            |||
  Fly   187 DYK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMGB3NP_001427702.1 None
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 22/68 (32%)

Return to query results.
Submit another query.